Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Beta-Defensin 3 peptide

Mouse Beta-Defensin 3 peptide (mBD3), a homolog of human beta-defensin 2 (hBD2), is a cysteine-rich cationic antimicrobial peptide of 41 amino acids which belongs to the defensins family. Defensin peptides are cationic peptides originally produced in various organs. They are involved in the protection against different kinds of pathogens like bacteria, fungi, and several viruses and play an important role in inflammation and wound repair. mBD3 peptide showed antimicrobial activity against Gram-negative bacteria S.Aureus and S.pyogenes and against Gram-positive bacteria like certain strains of P.Aeruginosa (MIC of 8 µg/mL) and E.coli (MIC of 16 µg/mL) . Antimicrobial activity has also been demonstrated against C.Albicans. The in vivo and in vitro efficiency of mBD3 against viruses like influenza was also shown. mBD3 can be interesting for therapeutic use.

Product Specifications

Product Name Alternative

MBD3

Sequence

KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK

Peptide Number

SB003

Disulfide Bonds

Cys8-Cys37, Cys15-Cys30, Cys20-Cys38

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FANCF (Fanconi Anemia Group B Protein, Protein FACB, Fanconi Anemia-associated Polypeptide of 95kD, FAAP95, MGC126856) (MaxLight 750) discontinued
126617-ML750 100 µL

FANCF (Fanconi Anemia Group B Protein, Protein FACB, Fanconi Anemia-associated Polypeptide of 95kD, FAAP95, MGC126856) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Anti-GUCY2D (7B6)
YF-MA20192 200 ul

Anti-GUCY2D (7B6)

Sign In for Pricing
View Details
LINGO2 Blocking Peptide
CBP5363-01 1 mg

LINGO2 Blocking Peptide

Sign In for Pricing
View Details
LINGO2 Blocking Peptide
CBP5363-02 5 mg

LINGO2 Blocking Peptide

Sign In for Pricing
View Details
CDS2 Antibody (Center)
E45G02547G-1 100 µL

CDS2 Antibody (Center)

Sign In for Pricing
View Details
Valinomycin
MBS3847259-01 5 mg

Valinomycin

Sign In for Pricing
View Details