Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP7, Human (His)

FABP7 Protein, Human (His) expresses in E. coliwith a His tag. Fatty Acid-Binding Protein 7 (FABP-7) is one of the subtypes of FABPs and preferentially binds to n-3 and n-9 polyunsaturated fatty acids (PUFAs) such as docosahexaenotic acid (DHA) and oleic acid, respectively. FABP-7 is thought to be an important molecule for cell proliferation in healthy as well as diseased organisms[1].

Product Specifications

Product Name Alternative

FABP7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp7-protein-human-his.html

Purity

98.0

Smiles

HHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

Molecular Formula

2173 (Gene_ID) O15540-1 (V2-A132) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Kagawa Y, et al. Role of FABP7 in tumor cell signaling. Adv Biol Regul. 2019;71:206-218.|[2]Kamizato K, et al. The role of fatty acid binding protein 7 in spinal cord astrocytes in a mouse model of experimental autoimmune encephalomyelitis. Neuroscience. 2019;409:120-129.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Monoclonal CD151 Antibody (455807) [HRP]
FAB4609H 0.1 mL

Rat Monoclonal CD151 Antibody (455807) [HRP]

Ask
View Details
Rabbit Monoclonal ALDH7A1 Antibody (105) [DyLight 350]
NBP2-89927UV 0.1 mL

Rabbit Monoclonal ALDH7A1 Antibody (105) [DyLight 350]

Ask
View Details
HSPB8/HSP22 Recombinant Protein Antigen
NBP1-84945PEP 0.1 mL

HSPB8/HSP22 Recombinant Protein Antigen

Ask
View Details
TREX1 Adenovirus (Rat)
47709056 1.0 mL

TREX1 Adenovirus (Rat)

Ask
View Details
Rat FGF6 (Fibroblast Growth Factor 6) QuickTest ELISA Kit
QT-ER0952 96 Tests

Rat FGF6 (Fibroblast Growth Factor 6) QuickTest ELISA Kit

Ask
View Details
COG2 Rabbit Polyclonal Antibody
TA370006 100 µL

COG2 Rabbit Polyclonal Antibody

Ask
View Details