Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP7, Human (His)

FABP7 Protein, Human (His) expresses in E. coliwith a His tag. Fatty Acid-Binding Protein 7 (FABP-7) is one of the subtypes of FABPs and preferentially binds to n-3 and n-9 polyunsaturated fatty acids (PUFAs) such as docosahexaenotic acid (DHA) and oleic acid, respectively. FABP-7 is thought to be an important molecule for cell proliferation in healthy as well as diseased organisms[1].

Product Specifications

Product Name Alternative

FABP7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp7-protein-human-his.html

Purity

98.0

Smiles

HHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

Molecular Formula

2173 (Gene_ID) O15540-1 (V2-A132) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Kagawa Y, et al. Role of FABP7 in tumor cell signaling. Adv Biol Regul. 2019;71:206-218.|[2]Kamizato K, et al. The role of fatty acid binding protein 7 in spinal cord astrocytes in a mouse model of experimental autoimmune encephalomyelitis. Neuroscience. 2019;409:120-129.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sheep Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit
MBS7217430-01 48 Well

Sheep Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit

Ask
View Details
Sheep Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit
MBS7217430-02 96 Well

Sheep Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit

Ask
View Details
Sheep Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit
MBS7217430-03 5x 96 Well

Sheep Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit

Ask
View Details
Sheep Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit
MBS7217430-04 10x 96 Well

Sheep Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit

Ask
View Details
OR4D9 (NM_001004711) Human Untagged Clone
SC300752 10 µg

OR4D9 (NM_001004711) Human Untagged Clone

Ask
View Details
Monkey Ankyrin repeat domain-containing protein 57 (ANKRD57) ELISA Kit
MBS7235556-01 48 Well

Monkey Ankyrin repeat domain-containing protein 57 (ANKRD57) ELISA Kit

Ask
View Details