Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP7, Human (His)

FABP7 Protein, Human (His) expresses in E. coliwith a His tag. Fatty Acid-Binding Protein 7 (FABP-7) is one of the subtypes of FABPs and preferentially binds to n-3 and n-9 polyunsaturated fatty acids (PUFAs) such as docosahexaenotic acid (DHA) and oleic acid, respectively. FABP-7 is thought to be an important molecule for cell proliferation in healthy as well as diseased organisms[1].

Product Specifications

Product Name Alternative

FABP7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp7-protein-human-his.html

Purity

98.0

Smiles

HHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

Molecular Formula

2173 (Gene_ID) O15540-1 (V2-A132) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Kagawa Y, et al. Role of FABP7 in tumor cell signaling. Adv Biol Regul. 2019;71:206-218.|[2]Kamizato K, et al. The role of fatty acid binding protein 7 in spinal cord astrocytes in a mouse model of experimental autoimmune encephalomyelitis. Neuroscience. 2019;409:120-129.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ectoderm-Neural Cortex Protein 1 (ENC1) Antibody
abx232759 100 µg

Ectoderm-Neural Cortex Protein 1 (ENC1) Antibody

Ask
View Details
Lentiviral human PDE10A shRNA (UAS) - Lentiviral human PDE10A shRNA (UAS, RFP) plasmid
GTR15083389 1 Vial

Lentiviral human PDE10A shRNA (UAS) - Lentiviral human PDE10A shRNA (UAS, RFP) plasmid

Ask
View Details