Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana GRF1-interacting factor 1 (GIF1)

Product Specifications

Product Name Alternative

GRF1-interacting factor 1 (AtGIF1) (Protein ANGUSTIFOLIA 3) (Transcription coactivator GIF1)

Abbreviation

Recombinant Mouse-ear cress GIF1 protein

Gene Name

GIF1

UniProt

Q8L8A5

Expression Region

1-210aa

Organism

Arabidopsis thaliana (Mouse-ear cress)

Target Sequence

MQQHLMQMQPMMAGYYPSNVTSDHIQQYLDENKSLILKIVESQNSGKLSECAENQARLQRNLMYLAAIADSQPQPPSVHSQYGSAGGGMIQGEGGSHYLQQQQATQQQQMTQQSLMAARSSMLYAQQQQQQQPYATLQHQQLHHSQLGMSSSSGGGGSSGLHILQGEAGGFHDFGRGKPEMGSGGGGEGRGGSSGDGGETLYLKSSDDGN

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Transcription coactivator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation (PubMed:19392710) . Appears to function synergistically with GRF1 as a transcriptional coactivator. Acts together with GRF5 for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation activity in leaf primordia. Plays a role in adaxial/abaxial patterning and growth in leaf morphogenesis. GIFs are involved in the positive regulation of cell proliferation of lateral organs in a functionally redundant manner. Together with GATA18/HAN, mediates cotyledon identity by preventing ectopic root formation through the repression of PLT1 expression (PubMed:22669825) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.8 kDa

References & Citations

"Stable establishment of cotyledon identity during embryogenesis in Arabidopsis by ANGUSTIFOLIA3 and HANABA TARANU." Kanei M., Horiguchi G., Tsukaya H. Development 139:2436-2446 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12931726/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Hist1h1a (H1f1) (NM_030609) Mouse Tagged ORF Clone Lentiviral Particle
MR222328L3V 200 µL

Hist1h1a (H1f1) (NM_030609) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
FAM165A AAV siRNA Pooled Vector
19822161 1.0 μg

FAM165A AAV siRNA Pooled Vector

Ask
View Details
Mouse S100A9 ELISA Kit (Chemiluminescence)
NBP2-62856 1 Kit

Mouse S100A9 ELISA Kit (Chemiluminescence)

Ask
View Details
Lsm7 ORF Vector (Rat) (pORF)
27752016 1.0 µg DNA

Lsm7 ORF Vector (Rat) (pORF)

Ask
View Details
Recombinant Human CDO (C-6His)
CU59-500ug 500 µg

Recombinant Human CDO (C-6His)

Ask
View Details
PH domain containing family G member 7 (PLEKHG7) Human shRNA Lentiviral Particle (Locus ID 440107)
TL315123V 500 µL Each

PH domain containing family G member 7 (PLEKHG7) Human shRNA Lentiviral Particle (Locus ID 440107)

Ask
View Details