Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNASE1L3, Human (His)

DNASE1L3 proteolytically cleaves single- and double-stranded DNA and generates fragments with 3'-OH termini. It can cleave chromatin, nucleosomes, and liposome-coated DNA. DNASE1L3 Protein, Human (His) is the recombinant human-derived DNASE1L3 protein, expressed by E. coli , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

DNASE1L3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/dnase1l3-protein-human-his.html

Purity

95

Smiles

MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Molecular Formula

1776 (Gene_ID) Q13609 (M21-S305) (Accession)

Molecular Weight

Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TUBGCP5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
48834066 1.0 µg DNA

TUBGCP5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Ask
View Details
HRP-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 21 (PTPN21)
MBS2072000-01 0.1 mL

HRP-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 21 (PTPN21)

Ask
View Details
HRP-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 21 (PTPN21)
MBS2072000-02 0.2 mL

HRP-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 21 (PTPN21)

Ask
View Details
HRP-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 21 (PTPN21)
MBS2072000-03 0.5 mL

HRP-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 21 (PTPN21)

Ask
View Details
HRP-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 21 (PTPN21)
MBS2072000-04 1 mL

HRP-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 21 (PTPN21)

Ask
View Details
HRP-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 21 (PTPN21)
MBS2072000-05 5 mL

HRP-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 21 (PTPN21)

Ask
View Details