Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ubiquitin-like protein ISG15 (Isg15)

Product Specifications

Product Name Alternative

(Interferon-induced 15 kDa protein) (Interferon-induced 17 kDa protein) (IP17) (Ubiquitin cross-reactive protein)

Abbreviation

Recombinant Mouse Isg15 protein

Gene Name

Isg15

UniProt

Q64339

Expression Region

1-155aa

Organism

Mus musculus (Mouse)

Target Sequence

MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGG

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cell Biology

Relevance

Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein (ISGylation) or via its action as a free or unconjugated protein. ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein. Its target proteins include SERPINA3G/SPI2A, JAK1, MAPK3/ERK1, PLCG1, TRIM25, STAT5A, MAPK1/ERK2 and globin. Isgylation of the viral sensor IFIH1/MDA5 promotes IFIH1/MDA5 oligomerization and triggers activation of innate immunity against a range of viruses, including coronaviruses, flaviviruses and picornaviruses. Can also isgylate: RIGI which inhibits its function in antiviral signaling response, IRF3 which inhibits its ubiquitination and degradation as well as EIF4E2 which enhances its cap structure-binding activity and translation-inhibition activity. Exhibits antiviral activity towards both DNA and RNA viruses, including influenza A and B virus, sindbis virus (SV) and herpes simplex type-1 (HHV-1) . Plays a significant role in the control of neonatal Chikungunya virus (CHIKV) infection by acting as a putative immunomodulator of pro-inflammatory cytokines. Protects mice against the consequences of Chikungunya virus infection by down-regulating the pathogenic cytokine response, often denoted as the cytokine storm. Plays a role in erythroid differentiation. The secreted form of ISG15 can: induce natural killer cell proliferation, act as a chemotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity. The secreted form acts through the integrin ITGAL/ITGB2 receptor to initiate activation of SRC family tyrosine kinases including LYN, HCK and FGR which leads to secretion of IFNG and IL10; the interaction is mediated by ITGAL (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.2 kDa

References & Citations

"Identification of interferon-stimulated gene 15 as an antiviral molecule during Sindbis virus infection in vivo." Lenschow D.J., Giannakopoulos N.V., Gunn L.J., Johnston C., O'Guin A.K., Schmidt R.E., Levine B., Virgin H.W. IV J. Virol. 79:13974-13983 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12934287/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RPL18P11 AAV siRNA Pooled Vector
40940161 1.0 μg

RPL18P11 AAV siRNA Pooled Vector

Ask
View Details
LOC100174910 CRISPRa sgRNA lentivector (set of three targets)(Rat)
26968126 3 x 1.0μg DNA

LOC100174910 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Ask
View Details
RAF1 Rabbit pAb
E47R23171 100ul

RAF1 Rabbit pAb

Ask
View Details
Recombinant Burkholderia pseudomallei Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS1052737-01 1 mg (E-Coli)

Recombinant Burkholderia pseudomallei Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Ask
View Details
Recombinant Burkholderia pseudomallei Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS1052737-02 1 mg (Yeast)

Recombinant Burkholderia pseudomallei Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Ask
View Details
Porcine Pentraxin 3 ELISA Kit
MBS739489-01 48 Well

Porcine Pentraxin 3 ELISA Kit

Ask
View Details