Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Angiopoietin-2 (ANGPT2)

Product Specifications

Product Name Alternative

(ANG-2)

Abbreviation

Recombinant Dog ANGPT2 protein

Gene Name

ANGPT2

UniProt

A0A8J8

Expression Region

19-495aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

YNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHSLLTMISPSKSPKDTFVAKEEQIIYRDCAEVFKSGLTTNGIYTLTFPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVFQVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating angiogenic signals mediated by ANGPT1. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

55.9 kDa

References & Citations

"Gene expressions of canine angiopoietin-1 and -2 in normal tissues and spontaneous tumours." Kato Y., Asano K., Mizutani I., Konno T., Sasaki Y., Kutara K., Teshima K., Edamura K., Kano R., Suzuki K., Shibuya H., Sato T., Hasegawa A., Tanaka S. Res. Vet. Sci. 81:280-286 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12932712/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CK18 Rabbit pAb
E47R2043 100ul

CK18 Rabbit pAb

Ask
View Details
Human G antigen 12G (GAGE12G) ELISA Kit
abx525190 96 Tests

Human G antigen 12G (GAGE12G) ELISA Kit

Ask
View Details
RBMS1 (RNA-binding Motif, Single-stranded-interacting Protein 1, Single-stranded DNA-binding Protein MSSP-1, Suppressor of CDC2 with RNA-binding Motif 2, C2orf12, MSSP, MSSP1, SCR2, MGC15146, MGC3331) (Biotin)
MBS6392168-01 0.1 mL

RBMS1 (RNA-binding Motif, Single-stranded-interacting Protein 1, Single-stranded DNA-binding Protein MSSP-1, Suppressor of CDC2 with RNA-binding Motif 2, C2orf12, MSSP, MSSP1, SCR2, MGC15146, MGC3331) (Biotin)

Ask
View Details
RBMS1 (RNA-binding Motif, Single-stranded-interacting Protein 1, Single-stranded DNA-binding Protein MSSP-1, Suppressor of CDC2 with RNA-binding Motif 2, C2orf12, MSSP, MSSP1, SCR2, MGC15146, MGC3331) (Biotin)
MBS6392168-02 5x 0.1 mL

RBMS1 (RNA-binding Motif, Single-stranded-interacting Protein 1, Single-stranded DNA-binding Protein MSSP-1, Suppressor of CDC2 with RNA-binding Motif 2, C2orf12, MSSP, MSSP1, SCR2, MGC15146, MGC3331) (Biotin)

Ask
View Details
Recombinant Human Protein phosphatase 2C-like domain-containing protein 1 (PP2D1)
MBS1056185-01 0.02 mg (E-Coli)

Recombinant Human Protein phosphatase 2C-like domain-containing protein 1 (PP2D1)

Ask
View Details
Recombinant Human Protein phosphatase 2C-like domain-containing protein 1 (PP2D1)
MBS1056185-02 0.02 mg (Yeast)

Recombinant Human Protein phosphatase 2C-like domain-containing protein 1 (PP2D1)

Ask
View Details