Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Androctonus mauretanicus mauretanicus Alpha-toxin Amm8

Product Specifications

Product Name Alternative

Alpha-anatoxin Amm VIII (Amm VIII) (AmmVIII) (Neurotoxin 8) (P4)

Abbreviation

Recombinant Androctonus mauretanicus mauretanicus Alpha-toxin Amm8 protein

UniProt

Q7YXD3

Expression Region

20-84aa

Organism

Androctonus mauritanicus mauritanicus (Scorpion)

Target Sequence

LKDGYIVNDINCTYFCGRNAYCNELCIKLKGESGYCQWASPYGNSCYCYKLPDHVRTKGPGRCND

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Alpha toxins bind voltage-independently at site-3 of sodium channels and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission . The toxin principally slows the inactivation process of TTX-sensitive sodium channels . It discriminates neuronal versus muscular sodium channel, as it is more potent on rat brain Nav1.2/SCN2A than on rat skeletal muscle Nav1.4/SCN4A . It also shows a weak activity on Nav1.7/SCN9A . In vivo, the toxin produces pain hypersensibility to mechanical and thermal stimuli.. It also exhibits potent analgesic activity, increasing hot plate and tail flick withdrawal latencies in a dose-dependent fashion . This paradoxical analgesic action, is significantly suppressed by opioid receptor antagonists, suggesting a pain-induced analgesia mechanism that involves an endogenous opioid system . This led to hypothesis that pain relief induced by peripheral administration of Amm VIII may result from sensitization of primary afferent neurons and subsequent activation of an opioid-dependent noxious inhibitory control .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.8 kDa

References & Citations

"New analysis of the toxic compounds from the Androctonus mauretanicus mauretanicus scorpion venom." Oukkache N., Rosso J.-P., Alami M., Ghalim N., Saile R., Hassar M., Bougis P.E., Martin-Eauclaire M.-F. Toxicon 51:835-852 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12927580/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Polyclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)
PAC977Ov01-01 20 µL

Polyclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)

Ask
View Details
Polyclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)
PAC977Ov01-02 100 µL

Polyclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)

Ask
View Details
Polyclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)
PAC977Ov01-03 200 µL

Polyclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)

Ask
View Details
Polyclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)
PAC977Ov01-04 1 mL

Polyclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)

Ask
View Details
Rabbit Polyclonal EIF1AD Antibody
NBP2-31728 0.1 mL

Rabbit Polyclonal EIF1AD Antibody

Ask
View Details
Recombinant Human Ki67/MKI67, N-His
MBS1574061-01 0.1 mg

Recombinant Human Ki67/MKI67, N-His

Ask
View Details