Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lassa virus RING finger protein Z (Z)

Product Specifications

Product Name Alternative

Zinc-binding protein

Abbreviation

Recombinant Lassa virus RING finger protein Z

Gene Name

Z

UniProt

O73557

Expression Region

2-99aa

Organism

Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)

Target Sequence

GNKQAKAPESKDSPRASLIPDATHLGPQFCKSCWFENKGLVECNNHYLCLNCLTLLLSVSNRCPICKMPLPTKLRPSAAPTAPPTGAADSIRPPPYSP

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Plays a crucial role in virion assembly and budding. Expressed late in the virus life cycle, it acts as an inhibitor of viral transcription and RNA synthesis by interacting with the viral polymerase L. Presumably recruits the NP encapsidated genome to cellular membranes at budding sites via direct interaction with NP. Plays critical roles in the final steps of viral release by interacting with host TSG101, a member of the vacuolar protein-sorting pathway and using other cellular host proteins involved in vesicle formation pathway. The budding of the virus progeny occurs after association of protein Z with the viral glycoprotein complex SSP-GP1-GP2 at the cell periphery, step that requires myristoylation of protein Z. Also selectively represses protein production by associating with host eIF4E.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.6 kDa

References & Citations

"Characterization of the Lassa virus matrix protein Z: electron microscopic study of virus-like particles and interaction with the nucleoprotein (NP) ." Eichler R., Strecker T., Kolesnikova L., ter Meulen J., Weissenhorn W., Becker S., Klenk H.D., Garten W., Lenz O. Virus Res. 100:249-255 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12929391/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TTF-1 / NKX2.1, Thyroid & Lung Epithelial Marker (Concentrate) Antibody
RA0310-C.5 0.5 mL

TTF-1 / NKX2.1, Thyroid & Lung Epithelial Marker (Concentrate) Antibody

Ask
View Details
Chicken Tyrosinase (TYR) ELISA Kit
MBS287378-01 48 Tests

Chicken Tyrosinase (TYR) ELISA Kit

Ask
View Details
Chicken Tyrosinase (TYR) ELISA Kit
MBS287378-02 96 Tests

Chicken Tyrosinase (TYR) ELISA Kit

Ask
View Details
Chicken Tyrosinase (TYR) ELISA Kit
MBS287378-03 5x 96 Tests

Chicken Tyrosinase (TYR) ELISA Kit

Ask
View Details
Chicken Tyrosinase (TYR) ELISA Kit
MBS287378-04 10x 96 Tests

Chicken Tyrosinase (TYR) ELISA Kit

Ask
View Details
PIP4K2C (E7P3S) Rabbit Monoclonal Antibody (PE Conjugate)
CST 95735S 100 µL

PIP4K2C (E7P3S) Rabbit Monoclonal Antibody (PE Conjugate)

Ask
View Details