Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse High mobility group protein B1 (Hmgb1), partial

Product Specifications

Product Name Alternative

High mobility group protein 1

Abbreviation

Recombinant Mouse Hmgb1 protein, partial

Gene Name

Hmgb1

UniProt

P63158

Expression Region

2-215aa

Organism

Mus musculus (Mouse)

Target Sequence

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Multifunctional redox sensitive protein with various roles in different cellular compartments. In the nucleus is one of the major chromatin-associated non-histone proteins and acts as a DNA chaperone involved in replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair and genome stability. Proposed to be an universal biosensor for nucleic acids. Promotes host inflammatory response to sterile and infectious signals and is involved in the coordination and integration of innate and adaptive immune responses. In the cytoplasm functions as sensor and/or chaperone for immunogenic nucleic acids implicating the activation of TLR9-mediated immune responses, and mediates autophagy. Acts as danger associated molecular pattern (DAMP) molecule that amplifies immune responses during tissue injury. Released to the extracellular environment can bind DNA, nucleosomes, IL-1 beta, CXCL12, AGER isoform 2/sRAGE, lipopolysaccharide (LPS) and lipoteichoic acid (LTA), and activates cells through engagement of multiple surface receptors. In the extracellular compartment fully reduced HMGB1 (released by necrosis) acts as a chemokine, disulfide HMGB1 (actively secreted) as a cytokine, and sulfonyl HMGB1 (released from apoptotic cells) promotes immunological tolerance (PubMed:23519706, PubMed:23446148, PubMed:23994764, PubMed:25048472) . Has proangiogenic activity (PubMed:16365390) . May be involved in platelet activation. Binds to phosphatidylserine and phosphatidylethanolamide. Bound to RAGE mediates signaling for neuronal outgrowth. May play a role in accumulation of expanded polyglutamine (polyQ) proteins (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.7 kDa

References & Citations

"A novel pathway of HMGB1-mediated inflammatory cell recruitment that requires Mac-1-integrin." Orlova V.V., Choi E.Y., Xie C., Chavakis E., Bierhaus A., Ihanus E., Ballantyne C.M., Gahmberg C.G., Bianchi M.E., Nawroth P.P., Chavakis T. EMBO J. 26:1129-1139 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12929412/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FITC anti-human/pig CD62E/CD62P
MBS9471489-01 25 Tests

FITC anti-human/pig CD62E/CD62P

Ask
View Details
FITC anti-human/pig CD62E/CD62P
MBS9471489-02 100 Tests

FITC anti-human/pig CD62E/CD62P

Ask
View Details
FITC anti-human/pig CD62E/CD62P
MBS9471489-03 5x 100 Tests

FITC anti-human/pig CD62E/CD62P

Ask
View Details
CCBL1 antibody
70R-16204 50 ul

CCBL1 antibody

Ask
View Details
Human Dual Specificity Protein Phosphatase 18 (DUSP18) AssayLite™ Antibody (FITC Conjugate)
35621-05141 2x 75 µg

Human Dual Specificity Protein Phosphatase 18 (DUSP18) AssayLite™ Antibody (FITC Conjugate)

Ask
View Details