Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Goat anti C. trachomatis EB

Product Specifications

CAS Number

9007-83-4

Storage Conditions

Short-term (up to 6 months) store at 2 to 8 °C. Long term, aliquot and store at -20 °C. Avoid multiple freeze/thaw cycles.

Specificity

Chlamydia trachomatis (EB's all antigens)<br>Purified elementary bodies, disrupted (all serovars A-K, L1-L3). Cross-reacts with Chlamydia psittacii and Chlamydia pneumoniae (TWAR). Negative against HEp-2 cells and egg yolk sac.

Short Name

[Chlamydia trachomatis (EB's all antigens)]

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NCAPG (Condensin Complex Subunit 3, Chromosome-associated Protein G, Condensin Subunit CAP-G, hCAP-G, Melanoma Antigen NY-MEL-3, Non-SMC Condensin I Complex Subunit G, XCAP-G Homolog, CAPG, NYMEL3) (Biotin)
130171-Biotin 100 µL

NCAPG (Condensin Complex Subunit 3, Chromosome-associated Protein G, Condensin Subunit CAP-G, hCAP-G, Melanoma Antigen NY-MEL-3, Non-SMC Condensin I Complex Subunit G, XCAP-G Homolog, CAPG, NYMEL3) (Biotin)

Ask
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
HY-P3431 1 Each

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Ask
View Details
Cesium chloride, 99%
GX6704-250g 250 g

Cesium chloride, 99%

Ask
View Details
IZUM3 rabbit pAb
MBS8599505-01 0.1 mL

IZUM3 rabbit pAb

Ask
View Details
IZUM3 rabbit pAb
MBS8599505-02 0.1 mL (AF405L)

IZUM3 rabbit pAb

Ask
View Details
IZUM3 rabbit pAb
MBS8599505-03 0.1 mL (AF405S)

IZUM3 rabbit pAb

Ask
View Details