Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-D, Mouse (HEK293, Fc)

VEGF-D Protein, a versatile growth factor, orchestrates angiogenesis, lymphangiogenesis, and endothelial cell growth. It stimulates proliferation, migration, and influences vessel permeability. VEGF-D binds VEGFR-3, triggering crucial signaling for vascular development. Structurally, VEGF-D is a non-covalent homodimer, emphasizing its intricate role in vascular processes. VEGF-D Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived VEGF-D protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

VEGF-D Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-d-protein-mouse-hek293-fc.html

Purity

96.00

Smiles

FYDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYS

Molecular Formula

14205 (Gene_ID) P97946 (F98-S206) (Accession)

Molecular Weight

Approximately 45 kDa & 36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat Thyroid Hormone Receptor Alpha (THRA) ELISA Kit
MBS7260199-01 48 Well

Goat Thyroid Hormone Receptor Alpha (THRA) ELISA Kit

Ask
View Details
Goat Thyroid Hormone Receptor Alpha (THRA) ELISA Kit
MBS7260199-02 96 Well

Goat Thyroid Hormone Receptor Alpha (THRA) ELISA Kit

Ask
View Details
Goat Thyroid Hormone Receptor Alpha (THRA) ELISA Kit
MBS7260199-03 5x 96 Well

Goat Thyroid Hormone Receptor Alpha (THRA) ELISA Kit

Ask
View Details
Goat Thyroid Hormone Receptor Alpha (THRA) ELISA Kit
MBS7260199-04 10x 96 Well

Goat Thyroid Hormone Receptor Alpha (THRA) ELISA Kit

Ask
View Details
CEBPD/E Colorimetric Cell-Based ELISA Kit
MBS9500761-01 1 Kit

CEBPD/E Colorimetric Cell-Based ELISA Kit

Ask
View Details
CEBPD/E Colorimetric Cell-Based ELISA Kit
MBS9500761-02 5x 1 Kit

CEBPD/E Colorimetric Cell-Based ELISA Kit

Ask
View Details