Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Ubiquitin-like protein ISG15 (ISG15)

Product Specifications

Product Name Alternative

Interferon-stimulated gene product 17 (Ubiquitin cross-reactive protein) (BoUCRP) (G1P2) (ISG17) (UCRP)

Abbreviation

Recombinant Bovine ISG15 protein

Gene Name

ISG15

UniProt

O02741

Expression Region

1-154aa

Organism

Bos taurus (Bovine)

Target Sequence

MGGDLTVKMLGGQEILVPLRDSMTVSELKQFIAQKINVPAFQQRLAHLDSREVLQEGVPLVLQGLRAGSTVLLVVQNCISILVRNDKGRSSPYEVQLKQTVAELKQQVCQKERVQADQFWLSFEGRPMDDEHPLEEYGLMKGCTVFMNLRLRGG

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein or via its action as a free or unconjugated protein. ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein. Exhibits antiviral activity towards both DNA and RNA viruses. The secreted form of ISG15 can: induce natural killer cell proliferation, augment lymphokine-activated-killer activity, induce dendritic cell maturation, act as a chemotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity. In response to IFN-tau secreted by the conceptus, may ligate to and regulate proteins involved in the release of prostaglandin F2-alpha, and thus prevent lysis of the corpus luteum and maintain the pregnancy.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.4 kDa

References & Citations

"Complementary deoxyribonucleic acid sequence encoding bovine ubiquitin cross-reactive protein: a comparison with ubiquitin and a 15-kDa ubiquitin homolog." Austin K.J., Pru J.K., Hansen T.R. Endocrine 5:191-197 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12927298/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Klhl7 ELISA Kit
ELI-31816r 96 Tests

Rat Klhl7 ELISA Kit

Ask
View Details
Human Glycine receptor subunit beta (GLRB) ELISA Kit
MBS280200-01 48 Tests

Human Glycine receptor subunit beta (GLRB) ELISA Kit

Ask
View Details
Human Glycine receptor subunit beta (GLRB) ELISA Kit
MBS280200-02 96 Tests

Human Glycine receptor subunit beta (GLRB) ELISA Kit

Ask
View Details
Human Glycine receptor subunit beta (GLRB) ELISA Kit
MBS280200-03 5x 96 Tests

Human Glycine receptor subunit beta (GLRB) ELISA Kit

Ask
View Details
Human Glycine receptor subunit beta (GLRB) ELISA Kit
MBS280200-04 10x 96 Tests

Human Glycine receptor subunit beta (GLRB) ELISA Kit

Ask
View Details
pF3A WG (BYDV) Flexi-hMK-1 Plasmid
PVTB00069-2a 2 µg

pF3A WG (BYDV) Flexi-hMK-1 Plasmid

Ask
View Details