Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rubella virus Structural polyprotein, partial

Product Specifications

Product Name Alternative

(p110) (Coat protein) (C) (E2 envelope glycoprotein) (E1 envelope glycoprotein)

Abbreviation

Recombinant Rubella virus Structural polyprotein, partial

UniProt

Q8VA10

Expression Region

301-534aa

Organism

Rubella virus (strain RN-UK86) (RUBV)

Target Sequence

GLQPRADMAAPPAPPQPPCAHGQHYGHHHHQLPFLGHDGHHGGTLRVGQHHRNASDVLPGHCLQGGWGCYNLSDWHQGTHVCHTKHMDFWCVEHDRPPPATPTPLTTAANSTTAATPATAPAPCHAGLNDSCGGFLSGCGPMRLRHGADTRCGRLICGLSTTAQYPPTRFACAMRWGLPPWELVVLTARPEDGWTCRGVPAHPGTRCPELVSPMGRATCSPASALWLATANALS

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

[Capsid protein]: Capsid protein interacts with genomic RNA and assembles into icosahedric core particles 65-70 nm in diameter. The resulting nucleocapsid eventually associates with the cytoplasmic domain of E2 at the cell membrane, leading to budding and formation of mature virions from host Golgi membranes. Phosphorylation negatively regulates RNA-binding activity, possibly delaying virion assembly during the viral replication phase. Capsid protein dimerizes and becomes disulfide-linked in the virion. Modulates genomic RNA replication. Modulates subgenomic RNA synthesis by interacting with human C1QBP/SF2P32. Induces both perinuclear clustering of mitochondria and the formation of electron-dense intermitochondrial plaques, both hallmarks of rubella virus infected cells. Induces apoptosis when expressed in transfected cells. ; [Spike glycoprotein E2]: Responsible for viral attachment to target host cell, by binding to the cell receptor. Its transport to the plasma membrane depends on interaction with E1 protein. The surface glycoproteins display an irregular helical organization and a pseudo-tetrameric inner nucleocapsid arrangement. ; [Spike glycoprotein E1]: Class II viral fusion protein. Fusion activity is inactive as long as E1 is bound to E2 in mature virion. After virus attachment to target cell and clathrin-mediated endocytosis, acidification of the endosome would induce dissociation of E1/E2 heterodimer and concomitant trimerization of the E1 subunits. This E1 homotrimer is fusion active, and promotes release of viral nucleocapsid in cytoplasm after endosome and viral membrane fusion. The cytoplasmic tail of spike glycoprotein E1 modulates virus release. The surface glycoproteins display an irregular helical organization and a pseudo-tetrameric inner nucleocapsid arrangement.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.8 kDa

References & Citations

"Phylogenetic analysis of rubella virus including new genotype I isolates." Hofmann J., Renz M., Meyer S., von Haeseler A., Liebert U.G. Virus Res. 96:123-128 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12933769/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FEZF2 AAV Vector (Rat) (CMV)
20470106 1 μg

FEZF2 AAV Vector (Rat) (CMV)

Ask
View Details
Lentiviral mouse Trim66 shRNA (UAS) - Lentiviral mouseTrim66 shRNA (UAS, GFP) (25)
GTR15296111 1 Vial

Lentiviral mouse Trim66 shRNA (UAS) - Lentiviral mouseTrim66 shRNA (UAS, GFP) (25)

Ask
View Details
SUPER-X PLEX ® Mouse Inflammation Panel, Antigen Standards: Pre-Mixed
SMM271 11 Plex

SUPER-X PLEX ® Mouse Inflammation Panel, Antigen Standards: Pre-Mixed

Ask
View Details
Lentiviral human HMSD shRNA (UAS) - Lentiviral human HMSD shRNA (UAS, GFP) (25)
GTR15353771 1 Vial

Lentiviral human HMSD shRNA (UAS) - Lentiviral human HMSD shRNA (UAS, GFP) (25)

Ask
View Details