Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Protein S100-B (S100B)

Product Specifications

Product Name Alternative

(S-100 protein beta chain) (S-100 protein subunit beta) (S100 calcium-binding protein B)

Abbreviation

Recombinant Bovine S100B protein

Gene Name

S100B

UniProt

P02638

Expression Region

2-92aa

Organism

Bos taurus (Bovine)

Target Sequence

SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE

Tag

N-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.3 kDa

References & Citations

"Structure of the Ca2+/S100B/NDR kinase peptide complex: insights into S100 target specificity and activation of the kinase." Bhattacharya S., Large E., Heizmann C.W., Hemmings B.A., Chazin W.J. Biochemistry 42:14416-14426 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12933542/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ccng2 ORF Vector (Mouse) (pORF)
15401014 1.0 µg DNA

Ccng2 ORF Vector (Mouse) (pORF)

Ask
View Details
Polyclonal Antibody to Interleukin 11 Receptor Alpha (IL11Ra)
PAE771Mu02-01 20 µL

Polyclonal Antibody to Interleukin 11 Receptor Alpha (IL11Ra)

Ask
View Details
Polyclonal Antibody to Interleukin 11 Receptor Alpha (IL11Ra)
PAE771Mu02-02 100 µL

Polyclonal Antibody to Interleukin 11 Receptor Alpha (IL11Ra)

Ask
View Details
Polyclonal Antibody to Interleukin 11 Receptor Alpha (IL11Ra)
PAE771Mu02-03 200 µL

Polyclonal Antibody to Interleukin 11 Receptor Alpha (IL11Ra)

Ask
View Details
Polyclonal Antibody to Interleukin 11 Receptor Alpha (IL11Ra)
PAE771Mu02-04 1 mL

Polyclonal Antibody to Interleukin 11 Receptor Alpha (IL11Ra)

Ask
View Details
STF 178-148*210-B7541 AC Signs
251361 Card of 1 Pictogram(s)

STF 178-148*210-B7541 AC Signs

Ask
View Details