Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA-binding protein FUS (FUS)

Product Specifications

Product Name Alternative

(75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)

Abbreviation

Recombinant Human FUS protein

Gene Name

FUS

UniProt

P35637

Expression Region

1-526aa

Organism

Homo sapiens (Human)

Target Sequence

MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

DNA/RNA-binding protein that plays a role in various cellular processes such as transcription regulation, RNA splicing, RNA transport, DNA repair and damage response . Binds to nascent pre-mRNAs and acts as a molecular mediator between RNA polymerase II and U1 small nuclear ribonucleoprotein thereby coupling transcription and splicing . Binds also its own pre-mRNA and autoregulates its expression; this autoregulation mechanism is mediated by non-sense-mediated decay . Plays a role in DNA repair mechanisms by promoting D-loop formation and homologous recombination during DNA double-strand break repair . In neuronal cells, plays crucial roles in dendritic spine formation and stability, RNA transport, mRNA stability and synaptic homeostasis .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

60.9 kDa

References & Citations

"ALS-associated FUS mutations result in compromised FUS alternative splicing and autoregulation." Zhou Y., Liu S., Liu G., Oztuerk A., Hicks G.G. PLoS Genet. 9:E1003895-E1003895 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12933387/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ABCE1 Human shRNA Lentiviral Particle (Locus ID 6059)
TL315018V 500 µL Each

ABCE1 Human shRNA Lentiviral Particle (Locus ID 6059)

Ask
View Details
RNASEH1 antibody
MBS5301307-01 0.05 mL

RNASEH1 antibody

Ask
View Details
RNASEH1 antibody
MBS5301307-02 5x 0.05 mL

RNASEH1 antibody

Ask
View Details
Plk3 antibody - C-terminal region
MBS3210563-01 0.1 mL

Plk3 antibody - C-terminal region

Ask
View Details
Plk3 antibody - C-terminal region
MBS3210563-02 5x 0.1 mL

Plk3 antibody - C-terminal region

Ask
View Details
ZRSR1, CT (ZRSR1, U2AF1-RS1, U2AF1L1, U2AF1P, U2AF1RS1, U2AFBPL, U2 small nuclear ribonucleoprotein auxiliary factor 35kD subunit-related protein 1, CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 1, U2(RNU2) small nuclear RNA au
MBS6000683-01 0.2 mL

ZRSR1, CT (ZRSR1, U2AF1-RS1, U2AF1L1, U2AF1P, U2AF1RS1, U2AFBPL, U2 small nuclear ribonucleoprotein auxiliary factor 35kD subunit-related protein 1, CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 1, U2(RNU2) small nuclear RNA au

Ask
View Details