Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-alpha 1/IFNA13, Human (HEK293, His)

IFN-alpha 1 (IFNA1), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 1 involves in the activation of JAK1 and TYK2 pathway[4], exerts function by inhibiting viral replication as well as modulating immune response[3]. IFN-alpha 1/IFNA13 Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.

Product Specifications

Product Name Alternative

IFN-alpha 1/IFNA13 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-alpha-1-protein-human-hek-293-his.html

Purity

98.0

Smiles

CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Molecular Formula

3439/3447 (Gene_ID) P01562 (C24-E189) (Accession)

Molecular Weight

Approximately 17-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Zoon KC, et al. Purification and characterization of multiple components of human lymphoblastoid interferon-alpha. J Biol Chem. 1992 Jul 25;267 (21) :15210-6.|[2]Zhang SY, et al. Inborn errors of interferon (IFN) -mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.|[3]Gibbert K, et al. IFN-α subtypes: distinct biological activities in anti-viral therapy. Br J Pharmacol. 2013 Mar;168 (5) :1048-58.|[4]De Ceuninck F, et al. IFN-α: A key therapeutic target for multiple autoimmune rheumatic diseases. Drug Discov Today. 2021 Oct;26 (10) :2465-2473.|[5]Lapenta C, et al. IFN-Alpha-Mediated Differentiation of Dendritic Cells for Cancer Immunotherapy: Advances and Perspectives. Vaccines (Basel) . 2020 Oct 19;8 (4) :617.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TPK1 Antibody
A37291-50UG 50 µg

TPK1 Antibody

Ask
View Details
ASK 1 Polyclonal Antibody
MBS2536576-01 0.02 mL

ASK 1 Polyclonal Antibody

Ask
View Details
ASK 1 Polyclonal Antibody
MBS2536576-02 0.06 mL

ASK 1 Polyclonal Antibody

Ask
View Details
ASK 1 Polyclonal Antibody
MBS2536576-03 0.12 mL

ASK 1 Polyclonal Antibody

Ask
View Details
ASK 1 Polyclonal Antibody
MBS2536576-04 0.2 mL

ASK 1 Polyclonal Antibody

Ask
View Details
Mapre2 (NM_153058) Mouse Tagged ORF Clone Lentiviral Particle
MR204749L3V 200 µL

Mapre2 (NM_153058) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details