Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stromal cell-derived factor 1 protein (CXCL12), partial (Active)

Product Specifications

Product Name Alternative

SDF-1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, IRH, hIRH

Abbreviation

Recombinant Human CXCL12 protein, partial (Active)

Gene Name

CXCL12

UniProt

P48061

Expression Region

21-119aa

Organism

Homo sapiens (Human)

Target Sequence

GKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKEKIGKKKRQKKRKAAQKRKN

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta (3-72) and SDF-1-alpha (3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha (3-67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. {ECO:0000269|PubMed:11069075, ECO:0000269|PubMed:11859124, ECO:0000269|PubMed:16107333, ECO:0000269|PubMed:18802065, ECO:0000269|PubMed:19255243, ECO:0000269|PubMed:8752281}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>96% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using PHA and rHuIL­2 activated human peripheral blood T­lymphocytes is in a concentration range of 30­100 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta (3-72) and SDF-1-alpha (3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha (3-67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation.

Molecular Weight

11.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/11098415/

Protein Length

Partial of Isoform Gamma

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287183 (DDB_G0287183)
MBS1398324-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287183 (DDB_G0287183)

Ask
View Details
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287183 (DDB_G0287183)
MBS1398324-02 0.1 mg (E-Coli)

Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287183 (DDB_G0287183)

Ask
View Details
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287183 (DDB_G0287183)
MBS1398324-03 0.02 mg (Yeast)

Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287183 (DDB_G0287183)

Ask
View Details
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287183 (DDB_G0287183)
MBS1398324-04 0.1 mg (Yeast)

Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287183 (DDB_G0287183)

Ask
View Details
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287183 (DDB_G0287183)
MBS1398324-05 0.02 mg (Baculovirus)

Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287183 (DDB_G0287183)

Ask
View Details
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287183 (DDB_G0287183)
MBS1398324-06 0.02 mg (Mammalian-Cell)

Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287183 (DDB_G0287183)

Ask
View Details