Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 alpha/IL-1F1, Pig

The IL-1α/IL-1F1 protein is found intracellularly in most non-hematopoietic cells and plays a crucial role in mediating inflammation and linking innate and adaptive immunity. IL1RAP binds to IL1R1 to form a high-affinity receptor complex that activates cascades and pathways.IL-1 alpha/IL-1F1 Protein, Pig is the recombinant Porcine-derived IL-1 alpha/IL-1F1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1 alpha/IL-1F1 Protein, Pig, Porcine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-alpha-il-1f1-protein-porcine.html

Purity

97.00

Smiles

QSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS

Molecular Formula

397094 (Gene_ID) P18430 (Q119-S270) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant human FLT3 protein with C-terminal human Fc and 6xHis tag
MBS188063-01 0.01 mg

Recombinant human FLT3 protein with C-terminal human Fc and 6xHis tag

Ask
View Details
Recombinant human FLT3 protein with C-terminal human Fc and 6xHis tag
MBS188063-02 0.05 mg

Recombinant human FLT3 protein with C-terminal human Fc and 6xHis tag

Ask
View Details
Recombinant human FLT3 protein with C-terminal human Fc and 6xHis tag
MBS188063-03 0.1 mg

Recombinant human FLT3 protein with C-terminal human Fc and 6xHis tag

Ask
View Details
Recombinant human FLT3 protein with C-terminal human Fc and 6xHis tag
MBS188063-04 5x 0.1 mg

Recombinant human FLT3 protein with C-terminal human Fc and 6xHis tag

Ask
View Details
Olfr1449 (NM_146303) Mouse Untagged Clone
MC213487 10 µg

Olfr1449 (NM_146303) Mouse Untagged Clone

Ask
View Details
5nm Standard Gold Nanoparticles
G-5-100 100 mL

5nm Standard Gold Nanoparticles

Ask
View Details