Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 alpha/IL-1F1, Pig

The IL-1α/IL-1F1 protein is found intracellularly in most non-hematopoietic cells and plays a crucial role in mediating inflammation and linking innate and adaptive immunity. IL1RAP binds to IL1R1 to form a high-affinity receptor complex that activates cascades and pathways.IL-1 alpha/IL-1F1 Protein, Pig is the recombinant Porcine-derived IL-1 alpha/IL-1F1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1 alpha/IL-1F1 Protein, Pig, Porcine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-alpha-il-1f1-protein-porcine.html

Purity

97.00

Smiles

QSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS

Molecular Formula

397094 (Gene_ID) P18430 (Q119-S270) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAMP3 Protein Vector (Human) (pPB-C-His)
PV045609 500 ng

VAMP3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Cdkn2b ORF Vector (Mouse) (pORF)
ORF041069 1.0 µg DNA

Cdkn2b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PRAMEF8 3'UTR GFP Stable Cell Line
TU068737 1.0 mL

PRAMEF8 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Clemizole hydrochloride 10mM * 1mL in DMSO
A15047-10mM-D 10 mM x 1mL in DMSO

Clemizole hydrochloride 10mM * 1mL in DMSO

Sign In for Pricing
View Details
TIE1 (NM_005424) Human Recombinant Protein
PH38352M5 20 µg

TIE1 (NM_005424) Human Recombinant Protein

Sign In for Pricing
View Details
ZNF33A (NM_001278179) Human Tagged ORF Clone
RC239344 10 µg

ZNF33A (NM_001278179) Human Tagged ORF Clone

Sign In for Pricing
View Details