Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD3 gamma chain (CD3G), partial

Product Specifications

Product Name Alternative

T-cell receptor T3 gamma chain; CD antigen CD3g

Abbreviation

Recombinant Human CD3G protein, partial

Gene Name

CD3G

UniProt

P09693

Expression Region

23-116aa

Organism

Homo sapiens (Human)

Target Sequence

QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12935609/

Protein Length

Partial of Isoform 6

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PLK3, CT (PLK3, CNK, FNK, PRK, Serine/threonine-protein kinase PLK3, Cytokine-inducible serine/threonine-protein kinase, FGF-inducible kinase, Polo-like kinase 3, Proliferation-related kinase)
MBS6009386-01 0.2 mL

PLK3, CT (PLK3, CNK, FNK, PRK, Serine/threonine-protein kinase PLK3, Cytokine-inducible serine/threonine-protein kinase, FGF-inducible kinase, Polo-like kinase 3, Proliferation-related kinase)

Ask
View Details
PLK3, CT (PLK3, CNK, FNK, PRK, Serine/threonine-protein kinase PLK3, Cytokine-inducible serine/threonine-protein kinase, FGF-inducible kinase, Polo-like kinase 3, Proliferation-related kinase)
MBS6009386-02 5x 0.2 mL

PLK3, CT (PLK3, CNK, FNK, PRK, Serine/threonine-protein kinase PLK3, Cytokine-inducible serine/threonine-protein kinase, FGF-inducible kinase, Polo-like kinase 3, Proliferation-related kinase)

Ask
View Details
Duck Pyruvate Kinase, Muscle ELISA Kit
MBS084607 Inquire

Duck Pyruvate Kinase, Muscle ELISA Kit

Ask
View Details
Rat Atypical Kinase COQ8A, Mitochondrial (COQ8A) ELISA Kit
abx501061 96 Tests

Rat Atypical Kinase COQ8A, Mitochondrial (COQ8A) ELISA Kit

Ask
View Details
Human Monoclonal TGF-beta 3 Antibody (Brigham and Womens anti-LAP) [DyLight 550]
NBP3-28029R 0.1 mL

Human Monoclonal TGF-beta 3 Antibody (Brigham and Womens anti-LAP) [DyLight 550]

Ask
View Details
Lysmd3 Mouse shRNA Plasmid (Locus ID 80289)
TL505336 1 Kit

Lysmd3 Mouse shRNA Plasmid (Locus ID 80289)

Ask
View Details