Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Unconventional myosin-X (MYO10), partial

Product Specifications

Product Name Alternative

(Unconventional myosin-10)

Abbreviation

Recombinant Human MYO10 protein, partial

Gene Name

MYO10

UniProt

Q9HD67

Expression Region

1669-1917aa

Organism

Homo sapiens (Human)

Target Sequence

ALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFTPCERLEKRRTSFLEGTLRRSFRTGSVVRQKVEEEQMLDMWIKEEV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. MYO10 binds to actin filaments and actin bundles and functions as a plus end-directed motor. Moves with higher velocity and takes larger steps on actin bundles than on single actin filaments. The tail domain binds to membranous compartments containing phosphatidylinositol 3,4,5-trisphosphate or integrins, and mediates cargo transport along actin filaments. Regulates cell shape, cell spreading and cell adhesion. Stimulates the formation and elongation of filopodia. In hippocampal neurons it induces the formation of dendritic filopodia by trafficking the actin-remodeling protein VASP to the tips of filopodia, where it promotes actin elongation. Plays a role in formation of the podosome belt in osteoclasts. ; [Isoform Headless]: Functions as a dominant-negative regulator of isoform 1, suppressing its filopodia-inducing and axon outgrowth-promoting activities. In hippocampal neurons, it increases VASP retention in spine heads to induce spine formation and spine head expansion.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12935319/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

2-Hydroxy-1,2,3-propanetricarboxylic Acid 2-Butyl Ester
sc-488161 50 mg

2-Hydroxy-1,2,3-propanetricarboxylic Acid 2-Butyl Ester

Ask
View Details
Mouse Monoclonal Ferritin Heavy Chain Antibody (962610)
MAB9354 100 µg

Mouse Monoclonal Ferritin Heavy Chain Antibody (962610)

Ask
View Details
Guinea pig Baculoviral IAP repeat-containing protein 5 (BIRC5) ELISA Kit
MBS7205082-01 48 Well

Guinea pig Baculoviral IAP repeat-containing protein 5 (BIRC5) ELISA Kit

Ask
View Details
Guinea pig Baculoviral IAP repeat-containing protein 5 (BIRC5) ELISA Kit
MBS7205082-02 96 Well

Guinea pig Baculoviral IAP repeat-containing protein 5 (BIRC5) ELISA Kit

Ask
View Details
Guinea pig Baculoviral IAP repeat-containing protein 5 (BIRC5) ELISA Kit
MBS7205082-03 5x 96 Well

Guinea pig Baculoviral IAP repeat-containing protein 5 (BIRC5) ELISA Kit

Ask
View Details
Guinea pig Baculoviral IAP repeat-containing protein 5 (BIRC5) ELISA Kit
MBS7205082-04 10x 96 Well

Guinea pig Baculoviral IAP repeat-containing protein 5 (BIRC5) ELISA Kit

Ask
View Details