Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Aldo-keto reductase family 1 member A1 (AKR1A1)

Product Specifications

Product Name Alternative

Alcohol dehydrogenase [NADP+; Aldehyde reductase; Glucuronate reductase; Glucuronolactone reductase

Abbreviation

Recombinant Pig AKR1A1 protein

Gene Name

AKR1A1

UniProt

P50578

Expression Region

2-325aa

Organism

Sus scrofa (Pig)

Target Sequence

AASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTVDGKRVPRDAGHPLYPFNDPY

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. Displays enzymatic activity towards endogenous metabolites such as aromatic and aliphatic aldehydes, ketones, monosaccharides and bile acids, with a preference for negatively charged substrates, such as glucuronate and succinic semialdehyde. Plays an important role in ascorbic acid biosynthesis by catalyzing the reduction of D-glucuronic acid and D-glucurono-gamma-lactone. Functions as a detoxifiying enzyme by reducing a range of toxic aldehydes. Reduces methylglyoxal and 3-deoxyglucosone, which are present at elevated levels under hyperglycemic conditions and are cytotoxic. Involved also in the detoxification of lipid-derived aldehydes like acrolein. Plays a role in the activation of procarcinogens, such as polycyclic aromatic hydrocarbon trans-dihydrodiols, and in the metabolism of various xenobiotics and drugs. Displays no reductase activity towards retinoids.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12937494/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Desulfovibrio vulgaris subsp. vulgaris UPF0597 protein Dvul_2496 (Dvul_2496)
MBS1257743-01 0.02 mg (E-Coli)

Recombinant Desulfovibrio vulgaris subsp. vulgaris UPF0597 protein Dvul_2496 (Dvul_2496)

Ask
View Details
Recombinant Desulfovibrio vulgaris subsp. vulgaris UPF0597 protein Dvul_2496 (Dvul_2496)
MBS1257743-02 0.02 mg (Yeast)

Recombinant Desulfovibrio vulgaris subsp. vulgaris UPF0597 protein Dvul_2496 (Dvul_2496)

Ask
View Details
Recombinant Desulfovibrio vulgaris subsp. vulgaris UPF0597 protein Dvul_2496 (Dvul_2496)
MBS1257743-03 0.1 mg (E-Coli)

Recombinant Desulfovibrio vulgaris subsp. vulgaris UPF0597 protein Dvul_2496 (Dvul_2496)

Ask
View Details
Recombinant Desulfovibrio vulgaris subsp. vulgaris UPF0597 protein Dvul_2496 (Dvul_2496)
MBS1257743-04 0.1 mg (Yeast)

Recombinant Desulfovibrio vulgaris subsp. vulgaris UPF0597 protein Dvul_2496 (Dvul_2496)

Ask
View Details
Recombinant Desulfovibrio vulgaris subsp. vulgaris UPF0597 protein Dvul_2496 (Dvul_2496)
MBS1257743-05 0.02 mg (Baculovirus)

Recombinant Desulfovibrio vulgaris subsp. vulgaris UPF0597 protein Dvul_2496 (Dvul_2496)

Ask
View Details
Recombinant Desulfovibrio vulgaris subsp. vulgaris UPF0597 protein Dvul_2496 (Dvul_2496)
MBS1257743-06 0.02 mg (Mammalian-Cell)

Recombinant Desulfovibrio vulgaris subsp. vulgaris UPF0597 protein Dvul_2496 (Dvul_2496)

Ask
View Details