Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda)

Product Specifications

Product Name Alternative

Activation-induced cytidine deaminase (AID) (Cytidine aminohydrolase) (Aid)

Abbreviation

Recombinant Mouse Aicda protein

Gene Name

Aicda

UniProt

Q9WVE0

Expression Region

1-198aa

Organism

Mus musculus (Mouse)

Target Sequence

MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Single-stranded DNA-specific cytidine deaminase. Involved in somatic hypermutation , gene conversion, and class-switch recombination in B-lymphocytes by deaminating C to U during transcription of Ig-variable and Ig-switch region DNA. Required for several crucial steps of B-cell terminal differentiation necessary for efficient antibody responses. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.5 kDa

References & Citations

"Specific expression of activation-induced cytidine deaminase (AID), a novel member of the RNA-editing deaminase family in germinal center B cells." Muramatsu M., Sankaranand V.S., Anant S., Sugai M., Kinoshita K., Davidson N.O., Honjo T. J. Biol. Chem. 274:18470-18476 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12927612/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

pCMV-SPORT6-LMF1 Plasmid
PVT13144 2 µg

pCMV-SPORT6-LMF1 Plasmid

Ask
View Details
Brilliant Violet 510™ anti-human CD127 (IL-7Rα)
GT12857 100 Tests

Brilliant Violet 510™ anti-human CD127 (IL-7Rα)

Ask
View Details
ZSCAN20 (Zinc Finger and SCAN Domain-containing Protein 20, Zinc Finger Protein 31, ZFP-31, ZNF31, Zinc Finger Protein 360, ZNF360, Zinc Finger Protein KOX29, KOX29) (MaxLight 650)
MBS6399335-01 0.1 mL

ZSCAN20 (Zinc Finger and SCAN Domain-containing Protein 20, Zinc Finger Protein 31, ZFP-31, ZNF31, Zinc Finger Protein 360, ZNF360, Zinc Finger Protein KOX29, KOX29) (MaxLight 650)

Ask
View Details
ZSCAN20 (Zinc Finger and SCAN Domain-containing Protein 20, Zinc Finger Protein 31, ZFP-31, ZNF31, Zinc Finger Protein 360, ZNF360, Zinc Finger Protein KOX29, KOX29) (MaxLight 650)
MBS6399335-02 5x 0.1 mL

ZSCAN20 (Zinc Finger and SCAN Domain-containing Protein 20, Zinc Finger Protein 31, ZFP-31, ZNF31, Zinc Finger Protein 360, ZNF360, Zinc Finger Protein KOX29, KOX29) (MaxLight 650)

Ask
View Details
Ccl28 Mouse shRNA Lentiviral Particle (Locus ID 56838)
TL513544V 500 µL Each

Ccl28 Mouse shRNA Lentiviral Particle (Locus ID 56838)

Ask
View Details