Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Complement factor I (Cfi)

Product Specifications

Product Name Alternative

C3B/C4B inactivator (If)

Abbreviation

Recombinant Mouse Cfi protein

Gene Name

Cfi

UniProt

Q61129

Expression Region

19-603aa

Organism

Mus musculus (Mouse)

Target Sequence

RSPSASDLPQEELVDQKCLLQKYTHRSCNKVFCQPWQRCIEGTCICKLPYQCPRAGTPVCAMNGRSYPTYCHQKSFECLHPEIKFSHNGTCAAEGKFNVSLIYGRTKTEGLVQVKLVDQDERMFICKNSWSMAEANVACVDLGFPLGVRDIQGSFNISGNLHINDTECLHVHCRGVETSLAECAFTKRRTELSNGLAGVVCYKQDADFPTSLSFQCVNGKHIPQEKACNGVNDCGDQSDELCCKGCRGNASLCKSGVCIPDQYKCNGEVDCITGEDESRCEEDRQQNIPKGLARSAQGEAEIETEETEMLTPGMDNERKRIKSLLPKLSCGVKRNTHTRRKRVIGGKPANVGDYPWQVAIKDGQRITCGGIYIGGCWILTAAHCVRPSRAHSYQVWTALLDWLKPNSQLGIQTVKRVIVHEKYNGATFQNDIALIEMKMHTGKKECELPNSVPACVPWSPYLFQPNDRCIISGWGRGKDNQKVYSLRWGEVDLIGNCSQFYPDRYYEKEMQCAGTRDGSIDACKGDSGGPLVCEDINNVTYVWGIVSWGENCGKPEFPGVYTRVANYFDWISYHVGRSLVSQHNV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Trypsin-like serine protease that plays an essential role in regulating the immune response by controlling all complement pathways. Inhibits these pathways by cleaving three peptide bonds in the alpha-chain of C3b and two bonds in the alpha-chain of C4b thereby inactivating these proteins. Essential cofactors for these reactions include factor H and C4BP in the fluid phase and membrane cofactor protein/CD46 and CR1 on cell surfaces. The presence of these cofactors on healthy cells allows degradation of deposited C3b by CFI in order to prevent undesired complement activation, while in apoptotic cells or microbes, the absence of such cofactors leads to C3b-mediated complement activation and subsequent opsonization.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

69.2 kDa

References & Citations

"Cloning and characterization of the non-catalytic heavy chain of mouse complement factor I gene: structure comparison with the human homologue." Yun Y.-S., Goldberger G., Minta J.O. Biochem. Mol. Biol. Int. 47:493-500 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12927399/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Wolbachia sp. subsp. Drosophila simulans Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS1178931-01 1 mg (E-Coli)

Recombinant Wolbachia sp. subsp. Drosophila simulans Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Ask
View Details
Recombinant Wolbachia sp. subsp. Drosophila simulans Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS1178931-02 1 mg (Yeast)

Recombinant Wolbachia sp. subsp. Drosophila simulans Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Ask
View Details
Gm6653 Mouse shRNA Plasmid (Locus ID 626115)
TR508970 1 Kit

Gm6653 Mouse shRNA Plasmid (Locus ID 626115)

Ask
View Details
Human Fibroblast Growth Factor 18 (FGF18) ELISA Kit
MBS2024710-01 24 Strip Well

Human Fibroblast Growth Factor 18 (FGF18) ELISA Kit

Ask
View Details
Human Fibroblast Growth Factor 18 (FGF18) ELISA Kit
MBS2024710-02 48 Well

Human Fibroblast Growth Factor 18 (FGF18) ELISA Kit

Ask
View Details
Human Fibroblast Growth Factor 18 (FGF18) ELISA Kit
MBS2024710-03 96 Well

Human Fibroblast Growth Factor 18 (FGF18) ELISA Kit

Ask
View Details