Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Annexin A5/ANXA5, Human (His)

Annexin A5 (ANXA5) protein acts as an anticoagulant, indirectly inhibiting the thromboplastin-specific complex in the coagulation cascade. ANXA5 exists as a monomer and its role is not limited to coagulation regulation, but also has binding interactions involving ATRX and EIF5B, suggesting its involvement in a variety of cells. Animal-Free Annexin A5/ANXA5 Protein, Human (His) is the recombinant human-derived animal-FreeAnnexin A5/ANXA5 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Annexin A5/ANXA5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-annexin-a5-anxa5-protein-human-his.html

Purity

95.0

Smiles

MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Molecular Formula

308 (Gene_ID) P08758 (M1-D320) (Accession)

Molecular Weight

Approximately 36.75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant RBM3 Antibody
RC-5898-01 50 μL

Recombinant RBM3 Antibody

Ask
View Details
Recombinant RBM3 Antibody
RC-5898-02 100 µL

Recombinant RBM3 Antibody

Ask
View Details
Recombinant RBM3 Antibody
RC-5898-03 1 mL

Recombinant RBM3 Antibody

Ask
View Details
Lentiviral human LPAR6 sgRNA gene knockout kit - Lentiviral human LPAR6 sgRNA gene knockout kit (25)
GTR15363666 1 Vial

Lentiviral human LPAR6 sgRNA gene knockout kit - Lentiviral human LPAR6 sgRNA gene knockout kit (25)

Ask
View Details
Mouse Monoclonal TROP-2 Antibody (TrMab-6) [Janelia Fluor 646]
NBP3-11851JF646 0.1 mL

Mouse Monoclonal TROP-2 Antibody (TrMab-6) [Janelia Fluor 646]

Ask
View Details
ASPN, ID (Asporin, Periodontal Ligament-associated Protein 1, PLAP-1, SLRR1C, PLAP1, UNQ215/PRO241)
MBS627351-01 0.2 mL

ASPN, ID (Asporin, Periodontal Ligament-associated Protein 1, PLAP-1, SLRR1C, PLAP1, UNQ215/PRO241)

Ask
View Details