Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human AT-rich interactive domain-containing protein 4B (ARID4B), partial

Product Specifications

Product Name Alternative

180 kDa Sin3-associated polypeptide (Sin3-associated polypeptide p180) (Breast cancer-associated antigen BRCAA1) (Histone deacetylase complex subunit SAP180) (Retinoblastoma-binding protein 1-like 1) (ARID domain-containing protein 4B) (BRCAA1) (RBBP1L1) (RBP1L1) (SAP180)

Abbreviation

Recombinant Human ARID4B protein, partial

Gene Name

ARID4B

UniProt

Q4LE39

Expression Region

167-415aa

Organism

Homo sapiens (Human)

Target Sequence

KQIDELLGKVVCVDYISLDKKKALWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTAPKPDAVLKQAFEQALEFHKSRTIPANWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKVVNK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the Sin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. Plays a role in the regulation of epigenetic modifications at the PWS/AS imprinting center near the SNRPN promoter, where it might function as part of a complex with RB1 and ARID4A. Involved in spermatogenesis, together with ARID4A, where it functions as a transcriptional coactivator for AR and enhances expression of genes required for sperm maturation. Regulates expression of the tight junction protein CLDN3 in the testis, which is important for integrity of the blood-testis barrier. Plays a role in myeloid homeostasis where it regulates the histone methylation state of bone marrow cells and expression of various genes involved in hematopoiesis. May function as a leukemia suppressor.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.8 kDa

References & Citations

"Characterization of BRCAA1 and its novel antigen epitope identification." Cui D., Jin G., Gao T.W., Sun T., Tian F., Estrada G.G., Gao H., Sarai A. Cancer Epidemiol. Biomarkers Prev. 13:1136-1145 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12927534/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SLC25A13 Antibody
A39914-100UL 100 µL

SLC25A13 Antibody

Ask
View Details
Dennd2a siRNA Oligos set (Mouse)
18015174 3 x 5 nmol

Dennd2a siRNA Oligos set (Mouse)

Ask
View Details
IST1 Rabbit pAb
E45R28589N 50 ul

IST1 Rabbit pAb

Ask
View Details
Ki-67 (Proliferating Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone MKI67/6517R]
MBS4382090-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Ki-67 (Proliferating Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone MKI67/6517R]

Ask
View Details
Ki-67 (Proliferating Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone MKI67/6517R]
MBS4382090-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Ki-67 (Proliferating Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone MKI67/6517R]

Ask
View Details
Ki-67 (Proliferating Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone MKI67/6517R]
MBS4382090-03 0.1 mg (Without BSA & Azide at 1mg/mL)

Ki-67 (Proliferating Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone MKI67/6517R]

Ask
View Details