Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free FGF basic/bFGF, Human (154a.a, )

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].Animal-Free FGF basic/bFGF Protein, Human (154a.a), consists of 154 amino acids, produced by E.coli with tag free.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free FGF basic/bFGF Protein, Human (154a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-fgf-basic-bfgf-protein-human-154a-a.html

Purity

98.0

Smiles

AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

2247 (Gene_ID) P09038-4 (A135-S288) (Accession)

Molecular Weight

Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TMCO5B Antibody (C-term) Blocking peptide
MBS9218361-01 0.5 mg

TMCO5B Antibody (C-term) Blocking peptide

Ask
View Details
TMCO5B Antibody (C-term) Blocking peptide
MBS9218361-02 5x 0.5 mg

TMCO5B Antibody (C-term) Blocking peptide

Ask
View Details
APOL5 Antibody
8C14543-AAT 50 µg

APOL5 Antibody

Ask
View Details
Olr808 AAV Vector (Rat) (CMV)
34699106 1 μg

Olr808 AAV Vector (Rat) (CMV)

Ask
View Details
Hepcidin (HAMP) Antibody
abx172792 1 mL

Hepcidin (HAMP) Antibody

Ask
View Details
Recombinant Sheep Endothelin-1 (EDN1)
MBS7097792-01 0.05 mg (E-Coli)

Recombinant Sheep Endothelin-1 (EDN1)

Ask
View Details