Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free FGF basic/bFGF, Human (154a.a, )

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].Animal-Free FGF basic/bFGF Protein, Human (154a.a), consists of 154 amino acids, produced by E.coli with tag free.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free FGF basic/bFGF Protein, Human (154a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-fgf-basic-bfgf-protein-human-154a-a.html

Purity

98.0

Smiles

AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

2247 (Gene_ID) P09038-4 (A135-S288) (Accession)

Molecular Weight

Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Luciferin, FREE ACID
#10100-1 1x 50 mg

D-Luciferin, FREE ACID

Sign In for Pricing
View Details
Mouse Syntaxin 1A, Brain (STX1A) ELISA Kit
RD-STX1A-Mu-01 96 Tests

Mouse Syntaxin 1A, Brain (STX1A) ELISA Kit

Sign In for Pricing
View Details
Mouse Syntaxin 1A, Brain (STX1A) ELISA Kit
RD-STX1A-Mu-02 48 Tests

Mouse Syntaxin 1A, Brain (STX1A) ELISA Kit

Sign In for Pricing
View Details
KDM3B Rabbit Polyclonal Antibody
TA368616 100 µL

KDM3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MTOR (Ab-2446) Antibody
8B1156-AAT 50 µg

MTOR (Ab-2446) Antibody

Sign In for Pricing
View Details
Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF568 conjugate, 0.1mg/mL
BNC682981-500 1x 500 µL

Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details