Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free FGF basic/bFGF, Human (154a.a, )

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].Animal-Free FGF basic/bFGF Protein, Human (154a.a), consists of 154 amino acids, produced by E.coli with tag free.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free FGF basic/bFGF Protein, Human (154a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-fgf-basic-bfgf-protein-human-154a-a.html

Purity

98.0

Smiles

AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

2247 (Gene_ID) P09038-4 (A135-S288) (Accession)

Molecular Weight

Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cntn4 (NM_173004) Mouse Tagged ORF Clone
MG219451 10 µg

Cntn4 (NM_173004) Mouse Tagged ORF Clone

Ask
View Details
Anti-GFRA3 Antibody
STJ60018 100 µg

Anti-GFRA3 Antibody

Ask
View Details
[Tyr0]-Agouti-Related Peptide (AgRP) (54-82) (Human)
003-73 100 μg

[Tyr0]-Agouti-Related Peptide (AgRP) (54-82) (Human)

Ask
View Details
Gng3 (NM_010316) Mouse Tagged Lenti ORF Clone
MR200101L4 10 µg

Gng3 (NM_010316) Mouse Tagged Lenti ORF Clone

Ask
View Details