Recombinant Human Pro-neuregulin-1, membrane-bound isoform protein (NRG1), partial (Active)
Product Specifications
Product Name Alternative
Pro-NRG1, ARIA, Breast cancer cell differentiation factor p45, Glial growth factor, Heregulin
Abbreviation
Recombinant Human NRG1 protein, partial (Active)
Gene Name
NRG1
UniProt
Q02297
Expression Region
177-237aa
Organism
Homo sapiens (Human)
Target Sequence
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ
Tag
Tag-Free
Type
Active Protein & In Stock Protein
Source
E.Coli
Field of Research
Neuroscience
Relevance
Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. {ECO:0000269|PubMed:1348215, ECO:0000269|PubMed:7902537}.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
>96% as determined by SDS-PAGE.
Activity
Yes
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 x 104 IU/mg.
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. Binds to ERBB4
Molecular Weight
7.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Product MSDS
https://www.cusabio.com/msds/11098545/
Protein Length
Partial of Isoform 12
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items