Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-neuregulin-1, membrane-bound isoform protein (NRG1), partial (Active)

Product Specifications

Product Name Alternative

Pro-NRG1, ARIA, Breast cancer cell differentiation factor p45, Glial growth factor, Heregulin

Abbreviation

Recombinant Human NRG1 protein, partial (Active)

Gene Name

NRG1

UniProt

Q02297

Expression Region

177-237aa

Organism

Homo sapiens (Human)

Target Sequence

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Neuroscience

Relevance

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. {ECO:0000269|PubMed:1348215, ECO:0000269|PubMed:7902537}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>96% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 x 104 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. Binds to ERBB4

Molecular Weight

7.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/11098545/

Protein Length

Partial of Isoform 12

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PSMB10 Antibody (C-term)
E45R03711G-1 100 ul

PSMB10 Antibody (C-term)

Ask
View Details
Monoclonal Antibody to E1A Binding Protein P300 (EP300)
MAC216Ra21-01 20 µL

Monoclonal Antibody to E1A Binding Protein P300 (EP300)

Ask
View Details
Monoclonal Antibody to E1A Binding Protein P300 (EP300)
MAC216Ra21-02 100 µL

Monoclonal Antibody to E1A Binding Protein P300 (EP300)

Ask
View Details
Monoclonal Antibody to E1A Binding Protein P300 (EP300)
MAC216Ra21-03 200 µL

Monoclonal Antibody to E1A Binding Protein P300 (EP300)

Ask
View Details
Monoclonal Antibody to E1A Binding Protein P300 (EP300)
MAC216Ra21-04 1 mL

Monoclonal Antibody to E1A Binding Protein P300 (EP300)

Ask
View Details
Anti-Hu CD2 FITC
MBS1800885-01 100 Tests

Anti-Hu CD2 FITC

Ask
View Details