Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Cynomolgus/Rhesus Macaque (HEK293, His)

CD47 is a leukocyte surface antigen, and high expression of CD47 helps tumors escape. CD47 inhibition leads to the activation of CD103+ dendritic cells, which leads to the recruitment and activation of natural killer cells and inhibits cancer development. CD47 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque, cynomolgus-derived CD47 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD47 Protein, Cynomolgus/Rhesus Macaque (HEK293, His), Rhesus Macaque; Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-cynomolgus-rhesus-macaque-hek293-c-his.html

Purity

97.0

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTAPANFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEN

Molecular Formula

704980/102139846 (Gene_ID) F7A802/NP_001253446 (Q19-N142) (Accession)

Molecular Weight

Approximately 30-43 kDa due to the glycosylation.

References & Citations

[1]Wang S, et al. Blocking CD47 promotes antitumour immunity through CD103+ dendritic cell-NK cell axis in murine hepatocellular carcinoma model. J Hepatol. 2022 Aug;77 (2) :467-478.|[2]Hayat SMG, et al. CD47: role in the immune system and application to cancer therapy. Cell Oncol (Dordr) . 2020 Feb;43 (1) :19-30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Progesterone receptor membrane component 2 ELISA kit
GTR10417521 96 Well

Rat Progesterone receptor membrane component 2 ELISA kit

Ask
View Details
Rabbit Anti-Mouse Complement C3 Convertase (C3 Convertase) Polyclonal Antibody
VD4N148 1 Each

Rabbit Anti-Mouse Complement C3 Convertase (C3 Convertase) Polyclonal Antibody

Ask
View Details
Cmc1 ORF Vector (Rat) (pORF)
16406016 1.0 µg DNA

Cmc1 ORF Vector (Rat) (pORF)

Ask
View Details