CD47, Cynomolgus/Rhesus Macaque (HEK293, His)
CD47 is a leukocyte surface antigen, and high expression of CD47 helps tumors escape. CD47 inhibition leads to the activation of CD103+ dendritic cells, which leads to the recruitment and activation of natural killer cells and inhibits cancer development. CD47 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque, cynomolgus-derived CD47 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CD47 Protein, Cynomolgus/Rhesus Macaque (HEK293, His), Rhesus Macaque; Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd47-protein-cynomolgus-rhesus-macaque-hek293-c-his.html
Purity
97.0
Smiles
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTAPANFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEN
Molecular Formula
704980/102139846 (Gene_ID) F7A802/NP_001253446 (Q19-N142) (Accession)
Molecular Weight
Approximately 30-43 kDa due to the glycosylation.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
