Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Noggin (NOG)

Product Specifications

Abbreviation

Recombinant Human NOG protein

Gene Name

NOG

UniProt

Q13253

Expression Region

28-232aa

Organism

Homo sapiens (Human)

Target Sequence

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite. Essential for cartilage morphogenesis and joint formation. Inhibits chondrocyte differentiation through its interaction with GDF5 and, probably, GDF6 (PubMed:21976273, PubMed:26643732) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

58.2 kDa

References & Citations

"A New Subtype of Multiple-Synostoses Syndrome is Caused by a Mutation in GDF6 that Decreases its Sensitivity to Noggin and Enhances its Potency as a BMP Signal." Wang J., Yu T., Wang Z., Ohte S., Yao R.E., Zheng Z., Geng J., Cai H., Ge Y., Li Y., Xu Y., Zhang Q., Gusella J.F., Fu Q., Pregizer S., Rosen V., Shen Y. J. Bone Miner. Res. 31:882-889 (2016)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human PRKAR1A (C-6His)
PHH1367-01 10 µg

Recombinant Human PRKAR1A (C-6His)

Ask
View Details
Recombinant Human PRKAR1A (C-6His)
PHH1367-02 50 µg

Recombinant Human PRKAR1A (C-6His)

Ask
View Details
Recombinant Human PRKAR1A (C-6His)
PHH1367-03 500 µg

Recombinant Human PRKAR1A (C-6His)

Ask
View Details
TSH2, NT (TSHZ2, C20orf17, TSH2, ZNF218, Teashirt homolog 2, Ovarian cancer-related protein 10-2, Zinc finger protein 218) (Biotin)
MBS6359487-01 0.2 mL

TSH2, NT (TSHZ2, C20orf17, TSH2, ZNF218, Teashirt homolog 2, Ovarian cancer-related protein 10-2, Zinc finger protein 218) (Biotin)

Ask
View Details
TSH2, NT (TSHZ2, C20orf17, TSH2, ZNF218, Teashirt homolog 2, Ovarian cancer-related protein 10-2, Zinc finger protein 218) (Biotin)
MBS6359487-02 5x 0.2 mL

TSH2, NT (TSHZ2, C20orf17, TSH2, ZNF218, Teashirt homolog 2, Ovarian cancer-related protein 10-2, Zinc finger protein 218) (Biotin)

Ask
View Details
Porcine Casein kinase I isoform delta (CSNK1D) ELISA Kit
MBS7209880-01 48 Well

Porcine Casein kinase I isoform delta (CSNK1D) ELISA Kit

Ask
View Details