HIST1H3A MORE Recombinant Protein (Human)
Product Specifications
Gene Name
H3 clustered histone 1|H3 clustered histone 10|H3 clustered histone 11|H3 clustered histone 12|H3 clustered histone 2|H3 clustered histone 3|H3 clustered histone 4|H3 clustered histone 6|H3 clustered histone 7|H3 clustered histone 8
Gene Aliases
H3 histone family, member A; H3 histone family, member B; H3 histone family, member C; H3 histone family, member D; H3 histone family, member F; H3 histone family, member H; H3 histone family, member I; H3 histone family, member J; H3 histone family, member K; H3 histone family, member L; H3.1; H3.f; H3/A; H3/b; H3/c; H3/d; H3/f; H3/h; H3/i; H3/j; H3/k; H3/l; H3C1; H3C10; H3C11; H3C12; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3F1K; H3FA; H3FB; H3FC; H3FD; H3FF; H3FH; H3FI; H3FJ; H3FK; H3FL; HIST1H3A; HIST1H3B; HIST1H3C; HIST1H3D; HIST1H3E; HIST1H3F; HIST1H3G; HIST1H3H; HIST1H3I; HIST1H3J; histone 1, H3a; histone 1, H3b; histone 1, H3c; histone 1, H3d; histone 1, H3e; histone 1, H3f; histone 1, H3g; histone 1, H3h; histone 1, H3i; histone 1, H3j; histone cluster 1 H3 family member a; histone cluster 1 H3 family member b; histone cluster 1 H3 family member c; histone cluster 1 H3 family member d; histone cluster 1 H3 family member e; histone cluster 1 H3 family member f; histone cluster 1 H3 family member g; histone cluster 1 H3 family member h; histone cluster 1 H3 family member i; histone cluster 1 H3 family member j; histone cluster 1, H3a; histone cluster 1, H3b; histone cluster 1, H3c; histone cluster 1, H3d; histone cluster 1, H3e; histone cluster 1, H3f; histone cluster 1, H3g; histone cluster 1, H3h; histone cluster 1, H3i; histone cluster 1, H3j; histone H3.1; histone H3/a; histone H3/b; histone H3/c; histone H3/d; histone H3/f; histone H3/h; histone H3/i; histone H3/j; histone H3/k; histone H3/l.
Gene ID
8350|8351|8352|8353|8354|8355|8356|8357|8358|8968
Accession Number
NP_003520
Reactivity
Homo sapiens|Human
Target
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Type
Protein
Source
E.coli
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
42.3 kDa
Protein Length
Recombinant
NCBI Gene Symbol
H3C1|H3C10|H3C11|H3C12|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8
Protein Name
Histone H3.1
Gene Name URL
H3C1|H3C10|H3C11|H3C12|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8
CAS Number
9000-83-3
Nucleotide Accession Number
NM_003529
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items