Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST1H3A MORE Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

H3 clustered histone 1|H3 clustered histone 10|H3 clustered histone 11|H3 clustered histone 12|H3 clustered histone 2|H3 clustered histone 3|H3 clustered histone 4|H3 clustered histone 6|H3 clustered histone 7|H3 clustered histone 8

Gene Aliases

H3 histone family, member A; H3 histone family, member B; H3 histone family, member C; H3 histone family, member D; H3 histone family, member F; H3 histone family, member H; H3 histone family, member I; H3 histone family, member J; H3 histone family, member K; H3 histone family, member L; H3.1; H3.f; H3/A; H3/b; H3/c; H3/d; H3/f; H3/h; H3/i; H3/j; H3/k; H3/l; H3C1; H3C10; H3C11; H3C12; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3F1K; H3FA; H3FB; H3FC; H3FD; H3FF; H3FH; H3FI; H3FJ; H3FK; H3FL; HIST1H3A; HIST1H3B; HIST1H3C; HIST1H3D; HIST1H3E; HIST1H3F; HIST1H3G; HIST1H3H; HIST1H3I; HIST1H3J; histone 1, H3a; histone 1, H3b; histone 1, H3c; histone 1, H3d; histone 1, H3e; histone 1, H3f; histone 1, H3g; histone 1, H3h; histone 1, H3i; histone 1, H3j; histone cluster 1 H3 family member a; histone cluster 1 H3 family member b; histone cluster 1 H3 family member c; histone cluster 1 H3 family member d; histone cluster 1 H3 family member e; histone cluster 1 H3 family member f; histone cluster 1 H3 family member g; histone cluster 1 H3 family member h; histone cluster 1 H3 family member i; histone cluster 1 H3 family member j; histone cluster 1, H3a; histone cluster 1, H3b; histone cluster 1, H3c; histone cluster 1, H3d; histone cluster 1, H3e; histone cluster 1, H3f; histone cluster 1, H3g; histone cluster 1, H3h; histone cluster 1, H3i; histone cluster 1, H3j; histone H3.1; histone H3/a; histone H3/b; histone H3/c; histone H3/d; histone H3/f; histone H3/h; histone H3/i; histone H3/j; histone H3/k; histone H3/l.

Gene ID

8350|8351|8352|8353|8354|8355|8356|8357|8358|8968

Accession Number

NP_003520

Reactivity

Homo sapiens|Human

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Type

Protein

Source

E.coli

Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

H3C1|H3C10|H3C11|H3C12|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8

Protein Name

Histone H3.1

Gene Name URL

H3C1|H3C10|H3C11|H3C12|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8

Nucleotide Accession Number

NM_003529

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL27 ELISA Kit (Mouse) (OKBB00780)
OKBB00780 96 Well

CCL27 ELISA Kit (Mouse) (OKBB00780)

Sign In for Pricing
View Details
PWC-PK-1 Write-on Adhesive-backed Markers
035400 120 Pack (12 Label (s) x 10 Sheet)

PWC-PK-1 Write-on Adhesive-backed Markers

Sign In for Pricing
View Details
IFIT3 Antibody, Biotin conjugated
A25846-100UG 100 µg

IFIT3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Recombinant human TRAIL/TNFSF10 protein
ATGP3588-010 10 µg

Recombinant human TRAIL/TNFSF10 protein

Sign In for Pricing
View Details
GW-1100 5mg
A11445-5 5 mg

GW-1100 5mg

Sign In for Pricing
View Details
CACNA1H
398634-01 50 µL

CACNA1H

Sign In for Pricing
View Details