Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST1H3A MORE Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

H3 clustered histone 1|H3 clustered histone 10|H3 clustered histone 11|H3 clustered histone 12|H3 clustered histone 2|H3 clustered histone 3|H3 clustered histone 4|H3 clustered histone 6|H3 clustered histone 7|H3 clustered histone 8

Gene Aliases

H3 histone family, member A; H3 histone family, member B; H3 histone family, member C; H3 histone family, member D; H3 histone family, member F; H3 histone family, member H; H3 histone family, member I; H3 histone family, member J; H3 histone family, member K; H3 histone family, member L; H3.1; H3.f; H3/A; H3/b; H3/c; H3/d; H3/f; H3/h; H3/i; H3/j; H3/k; H3/l; H3C1; H3C10; H3C11; H3C12; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3F1K; H3FA; H3FB; H3FC; H3FD; H3FF; H3FH; H3FI; H3FJ; H3FK; H3FL; HIST1H3A; HIST1H3B; HIST1H3C; HIST1H3D; HIST1H3E; HIST1H3F; HIST1H3G; HIST1H3H; HIST1H3I; HIST1H3J; histone 1, H3a; histone 1, H3b; histone 1, H3c; histone 1, H3d; histone 1, H3e; histone 1, H3f; histone 1, H3g; histone 1, H3h; histone 1, H3i; histone 1, H3j; histone cluster 1 H3 family member a; histone cluster 1 H3 family member b; histone cluster 1 H3 family member c; histone cluster 1 H3 family member d; histone cluster 1 H3 family member e; histone cluster 1 H3 family member f; histone cluster 1 H3 family member g; histone cluster 1 H3 family member h; histone cluster 1 H3 family member i; histone cluster 1 H3 family member j; histone cluster 1, H3a; histone cluster 1, H3b; histone cluster 1, H3c; histone cluster 1, H3d; histone cluster 1, H3e; histone cluster 1, H3f; histone cluster 1, H3g; histone cluster 1, H3h; histone cluster 1, H3i; histone cluster 1, H3j; histone H3.1; histone H3/a; histone H3/b; histone H3/c; histone H3/d; histone H3/f; histone H3/h; histone H3/i; histone H3/j; histone H3/k; histone H3/l.

Gene ID

8350|8351|8352|8353|8354|8355|8356|8357|8358|8968

Accession Number

NP_003520

Reactivity

Homo sapiens|Human

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Type

Protein

Source

E.coli

Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

H3C1|H3C10|H3C11|H3C12|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8

Protein Name

Histone H3.1

Gene Name URL

H3C1|H3C10|H3C11|H3C12|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8

Nucleotide Accession Number

NM_003529

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

COPS3 Peptide
42-405P 0.1 mg

COPS3 Peptide

Ask
View Details
Biotin-Linked Polyclonal Antibody to Motility Related Protein (MRP1)
MBS2092884-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Motility Related Protein (MRP1)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Motility Related Protein (MRP1)
MBS2092884-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Motility Related Protein (MRP1)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Motility Related Protein (MRP1)
MBS2092884-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Motility Related Protein (MRP1)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Motility Related Protein (MRP1)
MBS2092884-04 1 mL

Biotin-Linked Polyclonal Antibody to Motility Related Protein (MRP1)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Motility Related Protein (MRP1)
MBS2092884-05 5 mL

Biotin-Linked Polyclonal Antibody to Motility Related Protein (MRP1)

Ask
View Details