Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAD3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

SMAD family member 3

Gene Aliases

HMAD-3; hSMAD3; HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MAD homolog 3; mad homolog JV15-2; mad protein homolog; MAD, mothers against decapentaplegic homolog 3; mad3; MADH3; mothers against decapentaplegic homolog 3; mothers against DPP homolog 3; SMA- and MAD-related protein 3; SMAD family member 3; SMAD, mothers against DPP homolog 3.

Gene ID

4088

Accession Number

NP_001138574

Reactivity

Homo sapiens|Human

Target

Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD3/SMAD4 complex, activates transcription. Also can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. Has an inhibitory effect on wound healing probably by modulating both growth and migration of primary keratinocytes and by altering the TGF-mediated chemotaxis of monocytes. This effect on wound healing appears to be hormone-sensitive. Regulator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.

Type

Protein

Source

E.coli

Sequence

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

64.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SMAD3

Protein Name

Mothers against decapentaplegic homolog 3

Gene Name URL

SMAD3

Nucleotide Accession Number

NM_001145102

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DHX34 Antibody
NBP1-91832-25ul 25 µL

Rabbit Polyclonal DHX34 Antibody

Sign In for Pricing
View Details
UGT2B24P Protein Vector (Human) (pPB-N-His)
PV141907 500 ng

UGT2B24P Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant ASFV Mal-022 Protein (aa 37-69)
VAng-2149Lsx-1mg 1 mg

Recombinant ASFV Mal-022 Protein (aa 37-69)

Sign In for Pricing
View Details
FITC Anti-Mouse CD90.2/Thy1.2 Antibody (30H12)
FITC-30298-01 50 Tests

FITC Anti-Mouse CD90.2/Thy1.2 Antibody (30H12)

Sign In for Pricing
View Details
FITC Anti-Mouse CD90.2/Thy1.2 Antibody (30H12)
FITC-30298-02 100 Tests

FITC Anti-Mouse CD90.2/Thy1.2 Antibody (30H12)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Uncharacterized protein yibV (yibV)
MBS1352864-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Uncharacterized protein yibV (yibV)

Sign In for Pricing
View Details