Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RORC Recombinant Protein (Human)

Product Specifications

Gene Name

RAR related orphan receptor C

Gene Aliases

IMD42; NR1F3; nuclear receptor ROR-gamma; nuclear receptor RZR-gamma; nuclear receptor subfamily 1 group F member 3; RAR-related orphan nuclear receptor variant 2; RAR-related orphan receptor C; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; Retinoid-related orphan receptor-gamma; RORG; RZRG; RZR-GAMMA; TOR.

Gene ID

6097

Accession Number

NP_001001523

Reactivity

Homo sapiens|Human

Target

Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Key regulator of cellular differentiation, immunity, peripheral circadian rhythm as well as lipid, steroid, xenobiotics and glucose metabolism (PubMed:19381306, PubMed:19965867, PubMed:22789990, PubMed:26160376, PubMed:20203100) . Considered to have intrinsic transcriptional activity, have some natural ligands like oxysterols that act as agonists (25-hydroxycholesterol) or inverse agonists (7-oxygenated sterols), enhancing or repressing the transcriptional activity, respectively (PubMed:19965867, PubMed:22789990) . Recruits distinct combinations of cofactors to target gene regulatory regions to modulate their transcriptional expression, depending on the tissue, time and promoter contexts. Regulates the circadian expression of clock genes such as CRY1, ARNTL/BMAL1 and NR1D1 in peripheral tissues and in a tissue-selective manner. Competes with NR1D1 for binding to their shared DNA response element on some clock genes such as ARNTL/BMAL1, CRY1 and NR1D1 itself, resulting in NR1D1-mediated repression or RORC-mediated activation of the expression, leading to the circadian pattern of clock genes expression. Therefore influences the period length and stability of the clock. Involved in the regulation of the rhythmic expression of genes involved in glucose and lipid metabolism, including PLIN2 and AVPR1A (PubMed:19965867) . Negative regulator of adipocyte differentiation through the regulation of early phase genes expression, such as MMP3. Controls adipogenesis as well as adipocyte size and modulates insulin sensitivity in obesity. In liver, has specific and redundant functions with RORA as positive or negative modulator of expression of genes encoding phase I and Phase II proteins involved in the metabolism of lipids, steroids and xenobiotics, such as SULT1E1. Also plays also a role in the regulation of hepatocyte glucose metabolism through the regulation of G6PC and PCK1 (PubMed:19965867) . Regulates the rhythmic expression of PROX1 and promotes its nuclear localization (PubMed:19381306, PubMed:19965867, PubMed:22789990, PubMed:26160376, PubMed:20203100) . Plays an indispensable role in the induction of IFN-gamma dependent anti-mycobacterial systemic immunity (PubMed:26160376) .

Type

Protein

Source

E.coli

Sequence

MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

74.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RORC

Protein Name

Nuclear receptor ROR-gamma

Gene Name URL

RORC

CAS Number

9000-83-3

Nucleotide Accession Number

NM_001001523

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mogroside V
sc-280990B 100 mg

Mogroside V

Ask
View Details
Recombinant Human Lysocardiolipin acyltransferase 1 (LCLAT1)
CSB-CF012807HU-01 20 µg

Recombinant Human Lysocardiolipin acyltransferase 1 (LCLAT1)

Ask
View Details
Recombinant Human Lysocardiolipin acyltransferase 1 (LCLAT1)
CSB-CF012807HU-02 100 µg

Recombinant Human Lysocardiolipin acyltransferase 1 (LCLAT1)

Ask
View Details
Sprouty 1 (SPRY1) (NM_005841) Human Tagged ORF Clone Lentiviral Particle
RC209581L1V 200 µL

Sprouty 1 (SPRY1) (NM_005841) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Lipk siRNA Oligos set (Mouse)
26878174 3 x 5 nmol

Lipk siRNA Oligos set (Mouse)

Ask
View Details
Nxph1 (NM_012994) Rat Tagged ORF Clone Lentiviral Particle
RR213037L3V 200 µL

Nxph1 (NM_012994) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details