Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ube3a Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Ubiquitin protein ligase E3A

Gene Aliases

4732496B02;5830462N02Rik; A130086L21Rik; E6-AP ubiquitin protein ligase; HECT-type ubiquitin transferase E3A; Hpv; Hpve6a; oncogenic protein-associated protein E6-AP; ubiquitin conjugating enzyme E3A; ubiquitin-protein ligase E3A.

Gene ID

22215

Accession Number

NP_035798.2

Reactivity

Mouse|Mus musculus

Target

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and transfers it to its substrates. Several substrates have been identified including the ARNTL/BMAL1, ARC, RAD23A and RAD23B, MCM7 (which is involved in DNA replication), annexin A1, the PML tumor suppressor, and the cell cycle regulator CDKN1B (PubMed:20211139, PubMed:24728990) . Additionally, may function as a cellular quality control ubiquitin ligase by helping the degradation of the cytoplasmic misfolded proteins. Finally, UBE3A also promotes its own degradation in vivo (By similarity) . Plays an important role in the regulation of the circadian clock: involved in the ubiquitination of the core clock component ARNTL/BMAL1, leading to its proteasomal degradation (PubMed:24728990) . Acts as a regulator of synaptic development by mediating ubiquitination and degradation of ARC (PubMed:20211139) . Synergizes with WBP2 in enhancing PGR activity (By similarity) .

Type

Protein

Source

Mammalian Cells

Sequence

NPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDEATKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESVVIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ube3a

Host or Source

Mouse

Protein Name

Ubiquitin-protein ligase E3A

Gene Name URL

Ube3a

Nucleotide Accession Number

NM_011668.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYDC1 Over-expression Lysate Product
GWB-2A95C1 0.1 mg

DYDC1 Over-expression Lysate Product

Sign In for Pricing
View Details
NME4 Recombinant Protein (Human)
OPCA04916-1MG 1 mg

NME4 Recombinant Protein (Human)

Sign In for Pricing
View Details
ELISA Kit For Aryl hydrocarbon receptor
E1354m 96 Tests

ELISA Kit For Aryl hydrocarbon receptor

Sign In for Pricing
View Details
NGAL/Lipocalin 2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-41133R-BF594 100 µL

NGAL/Lipocalin 2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Recombinant Human UCHL1 protein (GST tag)
MBS2570728-01 0.02 mg

Recombinant Human UCHL1 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human UCHL1 protein (GST tag)
MBS2570728-02 0.1 mg

Recombinant Human UCHL1 protein (GST tag)

Sign In for Pricing
View Details