Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BotF Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Bontoxilysin-F.

Reactivity

Clostridium botulinum

Target

Botulinum neurotoxin type F: Botulinum toxin causes flaccid paralysis by inhibiting neurotransmitter (acetylcholine) release from the presynaptic membranes of nerve terminals of the eukaryotic host skeletal and autonomic nervous system, with frequent heart or respiratory failure. Precursor of botulinum neurotoxin F which may have 2 coreceptors; complex polysialylated gangliosides found on neural tissue and specific membrane-anchored proteins found in synaptic vesicles. Receptor proteins are exposed on host presynaptic cell membrane during neurotransmitter release, when the toxin heavy chain (HC) binds to them. Upon synaptic vesicle recycling the toxin is taken up via the endocytic pathway. When the pH of the toxin-containing endosome drops a structural rearrangement occurs so that the N-terminus of the HC forms pores that allows the light chain (LC) to translocate into the cytosol. Once in the cytosol the disulfide bond linking the 2 subunits is reduced and LC cleaves its target protein on synaptic vesicles, preventing their fusion with the cytoplasmic membrane and thus neurotransmitter release (By similarity) . Whole toxin only has protease activity after reduction, which releases LC (PubMed:8505288) . Requires complex eukaryotic host polysialogangliosides for full neurotoxicity (By similarity) . It is not clear whether a synaptic vesicle protein acts as its receptor; there is evidence for and against SV2 fulfilling this function (By similarity) .

Type

Protein

Source

Yeast

Sequence

MPVAINSFNYNDPVNDDTILYMQIPYEEKSKKYYKAFEIMRNVWIIPERNTIGTNPSDFDPPASLKNGSSAYYDPNYLTTDAEKDRYLKTTIKLFKRINSNPAGKVLLQEISYAKPYLGNDHTPIDEFSPVTRTTSVNIKLSTNVESSMLLNLLVLGAGPDIFESCCYPVRKLIDPDVVYDPSNYGFGSINIVTFSPEYEYTFNDISGGHNSSTESFIADPAISLAHELIHALHGLYGARGVTYEETIEVKQAPLMIAEKPIRLEEFLTFGGQDLNIITSAMKEKIYNNLLANYEKIATRLSEVNSAPPEYDINEYKDYFQWKYGLDKNADGSYTVNENKFNEIYKKLYSFTESDLANKFKVKCRNTYFIKYEFLKVPNLLDDDIYTVSEGFNIGNLAVNNRGQSIKLNPKIIDSIPDKGLVEKIVKFCKSVIPRK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

51.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BOTF

Host or Source

Clostridium botulinum

Protein Name

Botulinum neurotoxin type F

Gene Name URL

BOTF

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse AP-4 complex accessory subunit tepsin (TEPSIN) ELISA Kit
abx502055 96 Tests

Mouse AP-4 complex accessory subunit tepsin (TEPSIN) ELISA Kit

Ask
View Details
Caylin-1
MBS5797606 Inquire

Caylin-1

Ask
View Details
CSF2 antibody
70R-16614 50 ul

CSF2 antibody

Ask
View Details
Lentiviral human CILP sgRNA gene knockout kit - Lentiviral human CILP sgRNA gene knockout kit (25)
GTR15359946 1 Vial

Lentiviral human CILP sgRNA gene knockout kit - Lentiviral human CILP sgRNA gene knockout kit (25)

Ask
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) S1PR1 Polyclonal Antibody
MBS9009915 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) S1PR1 Polyclonal Antibody

Ask
View Details