Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5D Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

ATP synthase F1 subunit delta

Gene Aliases

ATP synthase F1 subunit delta; ATP synthase subunit delta, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit; ATP5D; F-ATPase delta subunit; MC5DN5; mitochondrial ATP synthase complex delta-subunit precusor; mitochondrial ATP synthase, delta subunit.

Gene ID

513

Reactivity

Homo sapiens|Human

Target

Mitochondrial membrane ATP synthase (F (1) F (0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F (1) - containing the extramembraneous catalytic core, and F (0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F (1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F (1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha (3) beta (3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.

Type

Protein

Source

Yeast

Sequence

AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ATP5F1D

Host or Source

Human

Protein Name

ATP synthase subunit delta, mitochondrial

Gene Name URL

ATP5F1D

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal RPRD1B Antibody (01) [Alexa Fluor 488]
NBP3-06202AF488 0.1 mL

Mouse Monoclonal RPRD1B Antibody (01) [Alexa Fluor 488]

Ask
View Details
Mouse Glutamate Cysteine Ligase, Catalytic (GCLC) ELISA Kit
MBS2023786-01 24 Strip Well

Mouse Glutamate Cysteine Ligase, Catalytic (GCLC) ELISA Kit

Ask
View Details
Mouse Glutamate Cysteine Ligase, Catalytic (GCLC) ELISA Kit
MBS2023786-02 48 Well

Mouse Glutamate Cysteine Ligase, Catalytic (GCLC) ELISA Kit

Ask
View Details
Mouse Glutamate Cysteine Ligase, Catalytic (GCLC) ELISA Kit
MBS2023786-03 96 Well

Mouse Glutamate Cysteine Ligase, Catalytic (GCLC) ELISA Kit

Ask
View Details
Mouse Glutamate Cysteine Ligase, Catalytic (GCLC) ELISA Kit
MBS2023786-04 5x 96 Well

Mouse Glutamate Cysteine Ligase, Catalytic (GCLC) ELISA Kit

Ask
View Details
Mouse Glutamate Cysteine Ligase, Catalytic (GCLC) ELISA Kit
MBS2023786-05 10x 96 Well

Mouse Glutamate Cysteine Ligase, Catalytic (GCLC) ELISA Kit

Ask
View Details