Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPC2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Epididymal secretory protein E1; Niemann Pick type C2 protein homolog.

Reactivity

Canis lupus|Dog

Target

Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the endosomal/lysosomal compartment. Both NPC1 and NPC2 function as the cellular 'tag team duo' (TTD) to catalyze the mobilization of cholesterol within the multivesicular environment of the late endosome (LE) to effect egress through the limiting bilayer of the LE. NPC2 binds unesterified cholesterol that has been released from LDLs in the lumen of the late endosomes/lysosomes and transfers it to the cholesterol-binding pocket of the N-terminal domain of NPC1. Cholesterol binds to NPC1 with the hydroxyl group buried in the binding pocket and is exported from the limiting membrane of late endosomes/ lysosomes to the ER and plasma membrane by an unknown mechanism. The secreted form of NCP2 regulates biliary cholesterol secretion via stimulation of ABCG5/ABCG8-mediated cholesterol transport (By similarity) .

Type

Protein

Source

E.coli

Sequence

VHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQIEG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NPC2

Host or Source

Dog

Protein Name

NPC intracellular cholesterol transporter 2

Gene Name URL

NPC2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sam 68 discontinued
542084-01 30ul

Sam 68 discontinued

Sign In for Pricing
View Details
Sam 68 discontinued
542084-02 100 µL

Sam 68 discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal ASB2 Antibody [Janelia Fluor 646]
NBP2-98774JF646 0.1 mL

Rabbit Polyclonal ASB2 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Cynomolgus / Rhesus Macaque CSF2RB CHO-S Cell Line
E24C00509 1 Vial

Cynomolgus / Rhesus Macaque CSF2RB CHO-S Cell Line

Sign In for Pricing
View Details
Recombinant Salinispora arenicola Catalase-peroxidase (katG), partial
MBS1138603 Inquire

Recombinant Salinispora arenicola Catalase-peroxidase (katG), partial

Sign In for Pricing
View Details
Anti-LXN/TCI Rabbit pAb
GB113785-50 50 μL

Anti-LXN/TCI Rabbit pAb

Sign In for Pricing
View Details