Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRCC5 Recombinant Protein

Product Specifications

Gene Name

X-ray repair cross complementing 5

Gene Aliases

86 kDa subunit of Ku antigen; ATP-dependent DNA helicase 2 subunit 2; ATP-dependent DNA helicase II 80 kDa subunit; CTC box-binding factor 85 kDa subunit; CTC85; CTCBF; DNA repair protein XRCC5; KARP1; KARP-1; Ku autoantigen, 80kDa; KU80; Ku86; Ku86 autoantigen related protein 1; KUB2; lupus Ku autoantigen protein p86; NFIV; nuclear factor IV; thyroid-lupus autoantigen; TLAA; X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) ; X-ray repair cross-complementing protein 5.

Gene ID

7520

Accession Number

NP_066964.1

Reactivity

Homo sapiens|Human

Target

Single-stranded DNA-dependent ATP-dependent helicase. Has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. Binding to DNA may be mediated by XRCC6. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V (D) J recombination. The XRCC5/6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5/6 dimer is probably involved in stabilizing broken DNA ends and bringing them together (PubMed:12145306, PubMed:20383123, PubMed:7957065, PubMed:8621488) . The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step. In association with NAA15, the XRCC5/6 dimer binds to the osteocalcin promoter and activates osteocalcin expression (PubMed:20383123) . The XRCC5/6 dimer probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site near double-strand breaks. XRCC5 probably acts as the catalytic subunit of 5'-dRP activity, and allows to 'clean' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined. The XRCC5/6 dimer together with APEX1 acts as a negative regulator of transcription (PubMed:8621488) . Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway.

Type

Protein

Source

E.coli

Sequence

LTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

XRCC5

Host or Source

Human

Protein Name

X-ray repair cross-complementing protein 5

Gene Name URL

XRCC5

CAS Number

9000-83-3

Nucleotide Accession Number

NM_021141.3

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TLX1 Polyclonal Antibody
E912861 100 µL

TLX1 Polyclonal Antibody

Ask
View Details
Fmoc-Ida-OH
5-04962 25 g

Fmoc-Ida-OH

Ask
View Details
DAP1 Rabbit mAb
MBS4761508-01 0.1 mL

DAP1 Rabbit mAb

Ask
View Details
DAP1 Rabbit mAb
MBS4761508-02 5x 0.1 mL

DAP1 Rabbit mAb

Ask
View Details
Recombinant Aedes aegypti RuvB-like helicase 2 (rept)
MBS1404369-01 0.02 mg (E-Coli)

Recombinant Aedes aegypti RuvB-like helicase 2 (rept)

Ask
View Details
Recombinant Aedes aegypti RuvB-like helicase 2 (rept)
MBS1404369-02 0.02 mg (Yeast)

Recombinant Aedes aegypti RuvB-like helicase 2 (rept)

Ask
View Details