Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBD Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Ubiquitin D

Gene Aliases

Diubiquitin; FAT10; GABBR1; UBD-3; ubiquitin D; ubiquitin-like protein FAT10.

Gene ID

10537

Accession Number

NP_006389.2

Reactivity

Homo sapiens|Human

Target

Ubiquitin-like protein modifier which can be covalently attached to target protein and subsequently leads to their degradation by the 26S proteasome, in a NUB1-dependent manner. Probably functions as a survival factor. Conjugation ability activated by UBA6. Promotes the expression of the proteasome subunit beta type-9 (PSMB9/LMP2) . Regulates TNF-alpha-induced and LPS-mediated activation of the central mediator of innate immunity NF-kappa-B by promoting TNF-alpha-mediated proteasomal degradation of ubiquitinated-I-kappa-B-alpha. Required for TNF-alpha-induced p65 nuclear translocation in renal tubular epithelial cells (RTECs) . May be involved in dendritic cell (DC) maturation, the process by which immature dendritic cells differentiate into fully competent antigen-presenting cells that initiate T-cell responses. Mediates mitotic non-disjunction and chromosome instability, in long-term in vitro culture and cancers, by abbreviating mitotic phase and impairing the kinetochore localization of MAD2L1 during the prometaphase stage of the cell cycle. May be involved in the formation of aggresomes when proteasome is saturated or impaired. Mediates apoptosis in a caspase-dependent manner, especially in renal epithelium and tubular cells during renal diseases such as polycystic kidney disease and Human immunodeficiency virus (HIV) -associated nephropathy (HIVAN) .

Type

Protein

Source

E.coli

Sequence

MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UBD

Host or Source

Human

Protein Name

Ubiquitin D

Gene Name URL

UBD

Nucleotide Accession Number

NM_006398.3

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LZIC Protein Lysate (Mouse) with C-HA Tag
27868034 100 μg

LZIC Protein Lysate (Mouse) with C-HA Tag

Ask
View Details
Horse Phosphatase and Actin Regulator 1 ELISA Kit
MBS042556-01 48 Well

Horse Phosphatase and Actin Regulator 1 ELISA Kit

Ask
View Details
Horse Phosphatase and Actin Regulator 1 ELISA Kit
MBS042556-02 96 Well

Horse Phosphatase and Actin Regulator 1 ELISA Kit

Ask
View Details
Horse Phosphatase and Actin Regulator 1 ELISA Kit
MBS042556-03 5x 96 Well

Horse Phosphatase and Actin Regulator 1 ELISA Kit

Ask
View Details
Horse Phosphatase and Actin Regulator 1 ELISA Kit
MBS042556-04 10x 96 Well

Horse Phosphatase and Actin Regulator 1 ELISA Kit

Ask
View Details
F13481-0050, laboratory tape, yellow, 12.7 mm wide, 12.7 m long
1214206 1 PC

F13481-0050, laboratory tape, yellow, 12.7 mm wide, 12.7 m long

Ask
View Details