Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A8 Recombinant Protein

Product Specifications

Gene Name

S100 calcium binding protein A8

Gene Aliases

Calgranulin-A; migration inhibitory factor-related protein 8; Mrp8; MRP-8; p8; protein S100-A8; S100 calcium binding protein A8 (calgranulin A) ; S100 calcium-binding protein A8.

Gene ID

116547

Accession Number

NP_446274.2

Reactivity

Rat|Rattus norvegicus

Target

S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve proinflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER) . Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn (2+) which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif; S100A8 seems to contribute to S-nitrosylation site selectivity (By similarity) .

Type

Protein

Source

E.coli

Sequence

ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

14.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

S100a8

Host or Source

Rat

Protein Name

Protein S100-A8

Gene Name URL

S100a8

CAS Number

9000-83-3

Nucleotide Accession Number

NM_053822.2

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

OTUB2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6F7]
TA501942BM 100 µL

OTUB2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6F7]

Ask
View Details
MMACHC (B-5) : m-IgG1 BP-HRP Bundle
sc-551542 1 Kit

MMACHC (B-5) : m-IgG1 BP-HRP Bundle

Ask
View Details
Eprs (NM_001024238) Rat Tagged ORF Clone
RR205417 10 µg

Eprs (NM_001024238) Rat Tagged ORF Clone

Ask
View Details
Etv5 siRNA Oligos set (Rat)
19535176 3 x 5 nmol

Etv5 siRNA Oligos set (Rat)

Ask
View Details
HCG23 3'UTR Lenti-reporter-Luc Vector
23086081 1.0 μg

HCG23 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
Cntnap1 siRNA Oligos set (Rat)
16520176 3 x 5 nmol

Cntnap1 siRNA Oligos set (Rat)

Ask
View Details