Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human HLA class II histocompatibility antigen, DQ alpha 2 chain

Product Specifications

Gene Name

Major histocompatibility complex, class II, DQ alpha 2

Gene Aliases

DC-1 alpha chain; DC-alpha; DX alpha chain; DX-ALPHA; HLA class II histocompatibility antigen, DQ alpha 1 chain; HLA class II histocompatibility antigen, DQ alpha 2 chain; HLA class II histocompatibility antigen, DQ (6) alpha chain; HLA-DCA; HLA-DQA1; HLADQA2; HLA-DXA; MHC class I antigen; MHC class II antigen; MHC class II DQA1; MHC class II DQA2.

Gene ID

3118

Reactivity

Homo sapiens|Human

Target

Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide) . The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading.

Type

Protein

Source

E.coli

Sequence

EDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSKFPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

25.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HLA-DQA2

Protein Name

HLA class II histocompatibility antigen, DQ alpha 2 chain

Gene Name URL

HLA-DQA2

CAS Number

9000-83-3

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UGT2B10 Antibody
OAAN03700-100UL 100 µL

UGT2B10 Antibody

Ask
View Details
Prostaglandin E Synthase 2/PTGES2 Recombinant Protein Antigen
NBP2-58108PEP 100 µL

Prostaglandin E Synthase 2/PTGES2 Recombinant Protein Antigen

Ask
View Details
ELISA Kit For HLA class I histocompatibility antigen, B-27 alpha chain
E1857h 96 Tests

ELISA Kit For HLA class I histocompatibility antigen, B-27 alpha chain

Ask
View Details
BCAT2 Polyclonal Antibody
E-AB-10996-01 20 µL

BCAT2 Polyclonal Antibody

Ask
View Details
BCAT2 Polyclonal Antibody
E-AB-10996-02 60 μL

BCAT2 Polyclonal Antibody

Ask
View Details
BCAT2 Polyclonal Antibody
E-AB-10996-03 120 μL

BCAT2 Polyclonal Antibody

Ask
View Details