Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

ISG15 ubiquitin like modifier

Gene Aliases

G1P2; hUCRP; IFI15; IMD38; interferon, alpha-inducible protein (clone IFI-15K) ; Interferon-induced 15 kDa protein; Interferon-induced 17 kDa protein; interferon-induced 17-kDa/15-kDa protein; interferon-stimulated protein, 15 kDa; IP17; ubiquitin cross-reactive protein; ubiquitin-like protein ISG15; UCRP.

Gene ID

9636

Reactivity

Homo sapiens|Human

Target

Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein (ISGylation) or via its action as a free or unconjugated protein. ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein. Its target proteins include IFIT1, MX1/MxA, PPM1B, UBE2L6, UBA7, CHMP5, CHMP2A, CHMP4B and CHMP6. Can also isgylate: EIF2AK2/PKR which results in its activation, DDX58/RIG-I which inhibits its function in antiviral signaling response, EIF4E2 which enhances its cap structure-binding activity and translation-inhibition activity, UBE2N and UBE2E1 which negatively regulates their activity, IRF3 which inhibits its ubiquitination and degradation and FLNB which prevents its ability to interact with the upstream activators of the JNK cascade therby inhibiting IFNA-induced JNK signaling. Exhibits antiviral activity towards both DNA and RNA viruses, including influenza A, HIV-1 and Ebola virus. Restricts HIV-1 and ebola virus via disruption of viral budding. Inhibits the ubiquitination of HIV-1 Gag and host TSG101 and disrupts their interaction, thereby preventing assembly and release of virions from infected cells. Inhibits Ebola virus budding mediated by the VP40 protein by disrupting ubiquitin ligase activity of NEDD4 and its ability to ubiquitinate VP40. ISGylates influenza A virus NS1 protein which causes a loss of function of the protein and the inhibition of virus replication. The secreted form of ISG15 can: induce natural killer cell proliferation, act as a chemotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity.

Type

Protein

Source

E.coli

Sequence

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ISG15

Protein Name

Ubiquitin-like protein ISG15

Gene Name URL

ISG15

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

USP45 Antibody
CSB-PA025737GA01HU 100 µL

USP45 Antibody

Ask
View Details
Tmem241 (NM_178801) Mouse Tagged ORF Clone Lentiviral Particle
MR217400L4V 200 µL

Tmem241 (NM_178801) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Rabbit Polyclonal CBP/KAT3A Antibody [CoraFluor 1]
NB100-381CL1 0.1 mL

Rabbit Polyclonal CBP/KAT3A Antibody [CoraFluor 1]

Ask
View Details
IRAK4 Antibody
F42537-0.08ML 0.08 mL

IRAK4 Antibody

Ask
View Details
DYRL1 rabbit pAb
RA32098-01 50 µL

DYRL1 rabbit pAb

Ask
View Details
DYRL1 rabbit pAb
RA32098-02 100 µL

DYRL1 rabbit pAb

Ask
View Details