Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human PHD finger-like domain-containing protein 5A

Product Specifications

Gene Name

PHD finger protein 5A

Gene Aliases

BK223H9.2; INI; PHD finger-like domain protein 5A; PHD finger-like domain-containing protein 5A; PHD-finger 5a; Rds3; SAP14b; SF3b14b; SF3B7; splicing factor 3B associated 14 kDa protein; splicing factor 3b, subunit 7; Splicing factor 3B-associated 14 kDa protein.

Gene ID

84844

Reactivity

Homo sapiens|Human

Target

Involved with the PAF1 complex (PAF1C) in transcriptional elongation by RNA polymerase II, and in regulation of development and maintenance of embryonic stem cell (ESC) pluripotency. Required for maintenance of ESCs self-renewal and cellular reprogramming of stem cells. Maintains pluripotency by recruiting and stabilizing PAF1C on pluripotency genes loci, and by regulating the expression of the pluripotency genes. Regulates the deposition of elongation-associated histone modifications, including dimethylated histone H3 'Lys-79' (H3K79me2) and trimethylated histone H3 'Lys-36' (H3K36me3), on PAF1C targets, self-renewal and pluripotency genes. Regulates RNA polymerase II promoter-proximal pause release of the PAF1C targets and self-renewal genes, and the levels of elongating ('Ser-2' phosphorylated) RNA polymerase II in their gene bodies. Regulates muscle specification in adult stem cells by stabilizing PAF1C in chromatin to promote myogenic differentiation (By similarity) . Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex (PubMed:27720643, PubMed:28541300) . SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (PubMed:12234937) . Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha (By similarity) .

Type

Protein

Source

E.coli

Sequence

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PHF5A

Protein Name

PHD finger-like domain-containing protein 5A

Gene Name URL

PHF5A

CAS Number

9000-83-3

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Magic™ Membrane Protein Human KIR2DL3 (Killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 3) Full Length
MPC2919K Each

Magic™ Membrane Protein Human KIR2DL3 (Killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 3) Full Length

Ask
View Details
OR5AP2-set siRNA/shRNA/RNAi Lentivector (Human)
35390091 4 x 500 ng

OR5AP2-set siRNA/shRNA/RNAi Lentivector (Human)

Ask
View Details
Striatin 3 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-12135R-BF594 100 µL

Striatin 3 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Ask
View Details
Gpm6b (NM_138846) Rat Tagged Lenti ORF Clone
RR206801L4 10 µg

Gpm6b (NM_138846) Rat Tagged Lenti ORF Clone

Ask
View Details
WNT9A Rabbit Polyclonal Antibody
MBS9466408-01 0.05 mL

WNT9A Rabbit Polyclonal Antibody

Ask
View Details
WNT9A Rabbit Polyclonal Antibody
MBS9466408-02 0.1 mL

WNT9A Rabbit Polyclonal Antibody

Ask
View Details