Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Forkhead box protein P1

Product Specifications

CAS Number

9000-83-3

Gene Name

Forkhead box P1

Gene Aliases

12CC4; fork head-related protein like B; forkhead box protein P1; glutamine-rich factor 1; hFKH1B; HSPC215; mac-1-regulated forkhead; MFH; QRF1.

Gene ID

27086

Reactivity

Homo sapiens|Human

Target

Transcriptional repressor (PubMed:18347093, PubMed:26647308) . Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential (By similarity) . Plays an important role in the specification and differentiation of lung epithelium. Acts cooperatively with FOXP4 to regulate lung secretory epithelial cell fate and regeneration by restricting the goblet cell lineage program; the function may involve regulation of AGR2. Essential transcriptional regulator of B-cell development. Involved in regulation of cardiac muscle cell proliferation. Involved in the columnar organization of spinal motor neurons. Promotes the formation of the lateral motor neuron column (LMC) and the preganglionic motor column (PGC) and is required for respective appropriate motor axon projections. The segment-appropriate generation of spinal chord motor columns requires cooperation with other Hox proteins. Can regulate PITX3 promoter activity; may promote midbrain identity in embryonic stem cell-derived dopamine neurons by regulating PITX3. Negatively regulates the differentiation of T follicular helper cells T (FH) s. Involved in maintenance of hair follicle stem cell quiescence; the function probably involves regulation of FGF18 (By similarity) . Represses transcription of various pro-apoptotic genes and cooperates with NF-kappa B-signaling in promoting B-cell expansion by inhibition of caspase-dependent apoptosis (PubMed:25267198) . Binds to CSF1R promoter elements and is involved in regulation of monocyte differentiation and macrophage functions; repression of CSF1R in monocytes seems to involve NCOR2 as corepressor (PubMed:15286807, PubMed:18799727, PubMed:18347093) . Involved in endothelial cell proliferation, tube formation and migration indicative for a role in angiogenesis; the role in neovascularization seems to implicate suppression of SEMA5B (PubMed:24023716) . Can negatively regulate androgen receptor signaling (PubMed:18640093) .

Type

Protein

Source

E.coli

Sequence

MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLLQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FOXP1

Protein Name

Forkhead box protein P1

Gene Name URL

FOXP1

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

XAGE3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
50503111 3 x 1.0 µg

XAGE3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Ask
View Details
MEGF6 Polyclonal Antibody
E11-200888 100 µg -100 µL

MEGF6 Polyclonal Antibody

Ask
View Details
Kcnj5 ORF Vector (Mouse) (pORF)
25386014 1.0 µg DNA

Kcnj5 ORF Vector (Mouse) (pORF)

Ask
View Details
Canine Acidic leucine rich nuclear phosphoprotein 32 family member A (ANP32A) ELISA kit
GTR10441906 96 Well

Canine Acidic leucine rich nuclear phosphoprotein 32 family member A (ANP32A) ELISA kit

Ask
View Details
PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody [Clone:1B8]
E45M15183 100 µg

PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody [Clone:1B8]

Ask
View Details