Recombinant human CD59 glyco protein
Product Specifications
Gene Name
CD59 molecule (CD59 blood group)
Gene Aliases
16.3A5;1F5;1F5 antigen;20 kDa homologous restriction factor; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344) ; CD59 blood group antigen; CD59 glycoprotein; CD59 molecule, complement regulatory protein; EJ16; EJ30; EL32; G344; HRF20; HRF-20; human leukocyte antigen MIC11; Ly-6-like protein; lymphocytic antigen CD59/MEM43; MACIF; MAC-inhibitory protein; MAC-IP; MEM43; MEM43 antigen; membrane attack complex (MAC) inhibition factor; membrane attack complex inhibition factor; membrane inhibitor of reactive lysis; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18-20; protectin; surface anitgen recognized by monoclonal antibody 16.3A5; T cell-activating protein.
Gene ID
966
Reactivity
Homo sapiens|Human
Target
Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.
Type
Protein
Source
E.coli
Sequence
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
36 kda
Protein Length
Recombinant
NCBI Gene Symbol
CD59
Protein Name
CD59 glycoprotein
Gene Name URL
CD59
CAS Number
9000-83-3
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items