Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHB1/2 Antibody (Phospho-Tyr594/604)

Product Specifications

CAS Number

9007-83-4

Gene Name

EPH receptor A2|EPH receptor B1|EPH receptor B2

Gene Aliases

ARCC2; BDPLT22; CAPB; CTPA; CTPP1; CTRCT6; developmentally-regulated Eph-related tyrosine kinase; DRT; ECK; EK5; EK6; ELK; elk-related tyrosine kinase; eph tyrosine kinase 2; eph tyrosine kinase 3; EPH-like kinase 5; EPH-like kinase 6; ephrin type-A receptor 2; ephrin type-B receptor 1; ephrin type-B receptor 2; EPHT2; EPHT3; Epithelial cell kinase; epithelial cell receptor protein tyrosine kinase; ERK; Hek5; Hek6; NET; neuronally-expressed EPH-related tyrosine kinase; PCBC; protein-tyrosine kinase HEK5; renal carcinoma antigen NY-REN-47; soluble EPHA2 variant 1; soluble EPHB1 variant 1; Tyro5; tyrosine-protein kinase receptor ECK; tyrosine-protein kinase receptor EPH-2; tyrosine-protein kinase receptor EPH-3; tyrosine-protein kinase TYRO5.

Gene ID

1969|2047|2048

Swiss Prot

P29317|P29323|P54762

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human EPHB1/2 around the phosphorylation site of Tyr594/604.

Target

Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Activated by the ligand ephrin-A1/EFNA1 regulates migration, integrin-mediated adhesion, proliferation and differentiation of cells. Regulates cell adhesion and differentiation through DSG1/desmoglein-1 and inhibition of the ERK1/ERK2 (MAPK3/MAPK1, respectively) signaling pathway. May also participate in UV radiation-induced apoptosis and have a ligand-independent stimulatory effect on chemotactic cell migration. During development, may function in distinctive aspects of pattern formation and subsequently in development of several fetal tissues. Involved for instance in angiogenesis, in early hindbrain development and epithelial proliferation and branching morphogenesis during mammary gland development. Engaged by the ligand ephrin-A5/EFNA5 may regulate lens fiber cells shape and interactions and be important for lens transparency development and maintenance. With ephrin-A2/EFNA2 may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis.|Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Cognate/functional ephrin ligands for this receptor include EFNB1, EFNB2 and EFNB3. During nervous system development, regulates retinal axon guidance redirecting ipsilaterally ventrotemporal retinal ganglion cells axons at the optic chiasm midline. This probably requires repulsive interaction with EFNB2. In the adult nervous system together with EFNB3, regulates chemotaxis, proliferation and polarity of the hippocampus neural progenitors. In addition to its role in axon guidance plays also an important redundant role with other ephrin-B receptors in development and maturation of dendritic spines and synapse formation. May also regulate angiogenesis. More generally, may play a role in targeted cell migration and adhesion. Upon activation by EFNB1 and probably other ephrin-B ligands activates the MAPK/ERK and the JNK signaling cascades to regulate cell migration and adhesion respectively. Involved in the maintenance of the pool of satellite cells (muscle stem cells) by promoting their self-renewal and reducing their activation and differentiation (By similarity) .|Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Functions in axon guidance during development. Involved in the guidance of commissural axons, that form a major interhemispheric connection between the 2 temporal lobes of the cerebral cortex. Also involved in guidance of contralateral inner ear efferent growth cones at the midline and of retinal ganglion cell axons to the optic disk. In addition to axon guidance, also regulates dendritic spines development and maturation and stimulates the formation of excitatory synapses. Upon activation by EFNB1, abolishes the ARHGEF15-mediated negative regulation on excitatory synapse formation. Controls other aspects of development including angiogenesis, palate development and in inner ear development through regulation of endolymph production. Forward and reverse signaling through the EFNB2/EPHB2 complex regulate movement and adhesion of cells that tubularize the urethra and septate the cloaca. May function as a tumor suppressor.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

IVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREF

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

109 kDa

Notes

Formerly GWB-ASB418

Specificity

EPHB1/2 (Phospho-Tyr594/604) Antibody detects endogenous levels of EPHB1/2 only when phosphorylated at Tyr594/604.

NCBI Gene Symbol

EPHA2|EPHB1|EPHB2

Host or Source

Rabbit

Protein Name

Ephrin type-A receptor 2|Ephrin type-B receptor 1|Ephrin type-B receptor 2

Gene Name URL

EPHA2|EPHB1|EPHB2

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Serpinb1c (NM_173051) Mouse Tagged ORF Clone Lentiviral Particle
MR218815L4V 200 µL

Serpinb1c (NM_173051) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Rnase1 AAV siRNA Pooled Vector
40192166 1.0 μg

Rnase1 AAV siRNA Pooled Vector

Ask
View Details
Phospho-Cdk2 (Tyr15) Rabbit Monoclonal Antibody
AF2317 50 µL

Phospho-Cdk2 (Tyr15) Rabbit Monoclonal Antibody

Ask
View Details