Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irf1 Antibody Middle region

Product Specifications

Gene Name

Interferon regulatory factor 1

Gene Aliases

Irf, Irf-1, AU020929

Gene ID

16362

Swiss Prot

P15314

Accession Number

NP_001152868.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse IRF1

Target

Transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses. These include the regulation of IFN and IFN-inducible genes, host response to viral and bacterial infections, regulation of many genes expressed during hematopoiesis, inflammation, immune responses and cell proliferation and differentiation, regulation of the cell cycle and induction of growth arrest and programmed cell death following DNA damage. Stimulates both innate and acquired immune responses through the activation of specific target genes and can act as a transcriptional activator and repressor regulating target genes by binding to an interferon-stimulated response element (ISRE) in their promoters. Its target genes for transcriptional activation activity are: genes involved in anti-viral response, such as IFN-alpha/beta, DDX58/RIG-I, TNFSF10/TRAIL, OAS1/2, PIAS1/GBP, EIF2AK2/PKR and RSAD2/viperin; antibacterial response, such as NOS2/INOS; anti-proliferative response, such as p53/TP53, LOX and CDKN1A; apoptosis, such as BBC3/PUMA, CASP1, CASP7 and CASP8; immune response, such as IL7, IL12A/B and IL15, PTGS2/COX2 and CYBB; DNA damage responses and DNA repair, such as POLQ/POLH; MHC class I expression, such as TAP1, PSMB9/LMP2, PSME1/PA28A, PSME2/PA28B and B2M and MHC class II expression, such as CIITA. Represses genes involved in anti-proliferative response, such as BIRC5/survivin, CCNB1, CCNE1, CDK1, CDK2 and CDK4 and in immune response, such as FOXP3, IL4, ANXA2 and TLR4. Stimulates p53/TP53-dependent transcription through enhanced recruitment of EP300 leading to increased acetylation of p53/TP53. Plays an important role in immune response directly affecting NK maturation and activity, macrophage production of IL12, Th1 development and maturation of CD8+ T-cells. Also implicated in the differentiation and maturation of dendritic cells and in the suppression of regulatory T (Treg) cells development. Acts as a tumor suppressor and plays a role not only in antagonism of tumor cell growth but also in stimulating an immune response against tumor cells.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSA

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

36 kDa

Protein Length

329

NCBI Gene Symbol

IRF1

Host or Source

Rabbit

Protein Name

Interferon regulatory factor 1

Gene Name URL

IRF1

CAS Number

9007-83-4

Nucleotide Accession Number

NM_001159396.1

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Pxylp1 (NM_001007710) Rat Tagged ORF Clone
RR206409 10 µg

Pxylp1 (NM_001007710) Rat Tagged ORF Clone

Ask
View Details
Anti-CEA/CEACAM5 Antibody Picoband® Fluoro488 Conjugated
A00356-2-Fluoro488 100 µg/Vial

Anti-CEA/CEACAM5 Antibody Picoband® Fluoro488 Conjugated

Ask
View Details
FITC-Linked Polyclonal Antibody to Stromal Cell Derived Factor 4 (SDF4)
MBS2046595-01 0.1 mL

FITC-Linked Polyclonal Antibody to Stromal Cell Derived Factor 4 (SDF4)

Ask
View Details
FITC-Linked Polyclonal Antibody to Stromal Cell Derived Factor 4 (SDF4)
MBS2046595-02 0.2 mL

FITC-Linked Polyclonal Antibody to Stromal Cell Derived Factor 4 (SDF4)

Ask
View Details
FITC-Linked Polyclonal Antibody to Stromal Cell Derived Factor 4 (SDF4)
MBS2046595-03 0.5 mL

FITC-Linked Polyclonal Antibody to Stromal Cell Derived Factor 4 (SDF4)

Ask
View Details
FITC-Linked Polyclonal Antibody to Stromal Cell Derived Factor 4 (SDF4)
MBS2046595-04 1 mL

FITC-Linked Polyclonal Antibody to Stromal Cell Derived Factor 4 (SDF4)

Ask
View Details